KEGG   Salvelinus alpinus (Arctic char): 111962725
Entry
111962725         CDS       T05762                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111962725
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111962725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111962725
Cytokines and growth factors [BR:salp04052]
 Growth factors
  Growth factors (RTK binding)
   111962725
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 111962725
NCBI-ProteinID: XP_023841795
LinkDB
AA seq 274 aa
MKKPKIWIRICVHLLLCITLGVQSSEFGNTVTDDITSISLLKQNIPKDYKIPVTYVPKEV
GGMCWVALNVFHLELSLRGLADKFGSISSNKYNISILIEMLKETRYHMKNLEAITYDFEC
HYRNEQWQTGHYFHFVEDFLKTARLNRDLPEECDPPPCPTATMATTITTQYPTSVNYPAI
GTEFNMSAPDSETWNERLRFLPEVVERSLLSLLVIPIAAVVFLFAWKVKSRRNQHQSDER
NSVEGGLFTGPEGTLAPPLEEPSEKNRLNIIETV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagccaaaaatttggatacgcatctgtgtccatttattgctgtgcatcacactt
ggagtccagtcaagtgaatttggaaacactgtgacagatgacatcacaagcatttcacta
ttgaaacaaaatatacctaaagattacaagattcctgtgacatacgttccgaaagaagtg
ggtggaatgtgttgggtagcgctaaacgttttccacttggaactcagtttacgaggatta
gcagacaagtttggaagcatttcgtccaacaaatataatatcagcatattgatcgaaatg
ctgaaagagacaagatatcacatgaagaacttggaggcgatcacgtatgattttgagtgc
cactacagaaatgagcaatggcagacaggacactattttcattttgtcgaagatttttta
aaaacggcccgtttgaatagagatttgccagaagaatgtgatccacctccctgtcccaca
gcaacaatggctacaacaataacaacacaataccccacatcagtcaactatcctgccata
ggaacagaattcaacatgtcagcaccagactccgaaacctggaacgagcgtctgagattc
ctgccagaagtagtggagagaagcctcctgtcactacttgtcattcctattgcagccgtt
gtgtttctgtttgcgtggaaggtgaaatccaggaggaaccaacatcagtcagatgaacgg
aactcagtggaaggaggccttttcacaggaccagaagggactttggcacctccactagag
gaaccatctgaaaagaacagattgaacatcattgagacagtgtaa

DBGET integrated database retrieval system