KEGG   Salvelinus alpinus (Arctic char): 111963070Help
Entry
111963070         CDS       T05762                                 

Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00270  Cysteine and methionine metabolism
salp01100  Metabolic pathways
Module
salp_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    111963070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:salp03032]
    111963070
   03036 Chromosome and associated proteins [BR:salp03036]
    111963070
Enzymes [BR:salp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     111963070
DNA replication proteins [BR:salp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    111963070
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111963070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase
Motif
Other DBs
NCBI-GeneID: 111963070
NCBI-ProteinID: XP_023842054
LinkDB All DBs
AA seq 954 aa AA seqDB search
MPSNTVATNNTAAFQSLDYTCDASGNRMRESAILDTELAPDETSSKSNTSCKEGRPAGRK
HKHISAEGSVSVKDSVAGGGGNSLTGVAAERERVSVAQVQNGVMSGGYTDRDRTQADASS
CPKQERKGPEKNGLPGAPGSSSASQAEDGPPGPPTLLHQSRSPPSLENRFLVSREPSQDE
QDDSEKNKEETLTTPPRKKRGRRKLERPTKYVEQKEDGGDTAKNQGVGGPGTGRLRGSVS
LRQRPMPRVTFQAGDPYYISKRTREEWLAXXXXXXXXQWKMEAEKKAQLVSVLNLMEAHE
EMAPEATTEKEEVSVINPHQQQQQQQQQPTDSVPTDGRDSAIGRAGVAGGLRGCFLVALV
RYCLLVDAGTQPSCRRGHDGFMWFADSINAPMYKQQSSLRGLQMASTRAGKTFLACPESD
ETDTSKSVDLHNNQMIDWAVTGFQPTGPKGLEPPEEERNPYKEVYPDVWVEPEAAAYTPP
PAKKPRKSTAAEKPKVKEMIDEGTRAIRVYPLVGFTTTSLACTNYILSFSTDICISCGSL
NVSREHPLFAGGMCQSCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCV
ECVDLLVGPGAAQIAIKEDPWCCYMCEKGQKGVFGLLERHTDWPCRLQHFFANNHDQDFE
QPKLYPPVMAEKRQPIRVLSLFDGIATGLLVLKELGIQVERYVASEVCEDSITVGIVRHQ
GRIMYVGDVRNVTRKHLHEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLL
HEARPKEGDNRPFFWLFENVVAMGVSDKRDISRFLECNPVMIDAKEVTAAHRARYFWGNL
PGMNRPLMAMFTDRLDLQDCLEHGRTAKFGKVRTITTRSNSIKQGKDQHFPVFMNEKEDI
LWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacactgttgccaccaacaacaccgctgcattccaaagcttagactacacc
tgtgatgcatctgggaacagaatgagggagagcgcgatactggacacagagttggcacca
gacgagacatcctctaaaagcaacaccagctgtaaagagggccggcctgctgggagaaaa
cacaagcacatctctgcggagggcagtgtgtctgtgaaggacagtgtggccggaggcggg
ggcaacagtctcaccggggtggcagcggaaagagagagagtgtctgtggcgcaggtgcag
aatggagtcatgagcggcgggtacacagacagagacaggacccaggctgatgccagcagc
tgccccaagcaagagaggaaaggtccagagaagaacgggttaccaggtgcccctggttcc
tccagtgccagtcaggctgaagacggccccccgggaccacccaccctcctgcatcagagc
cggagccccccctccctggaaaacaggtttctagtgagccgggagccgagccaggacgag
caggacgactctgagaaaaacaaagaggagactctgacaactccgccacgtaagaaacga
ggcaggcggaaactggagcgcccaacgaaatatgtggagcagaaggaggacggaggtgat
acagccaagaaccagggagttggaggccctgggacaggcaggctgcgtggctccgtcagt
ctgcgtcagaggcccatgcccagagtaaccttccaggccggtgacccatattacattagc
aagaggaccagggaggagtggctggcnnnnnnnnnnnnnnnnnnnnnnnnncaatggaag
atggaggcagagaaaaaagcccaactggtatcagtgttgaacttaatggaggcccatgag
gagatggcgcctgaagccacaacagaaaaggaagaggtgtcagtcatcaacccccaccag
caacaacaacaacaacaacaacagcccacggacagcgtcccgactgacgggcgggattcg
gcgattgggagggctggtgtggcgggaggtctgagggggtgtttcctggtggccttggtt
cgttattgtctcctggtggatgccgggacgcagccgagctgccgcaggggacacgatggg
ttcatgtggttcgccgactctatcaatgcgcccatgtataagcaacagtccagtctacga
gggctacagatggctagcacccgtgcaggcaaaaccttccttgcctgtccagagagcgat
gagacagacacctccaagtcagtggatctacacaacaaccagatgatagattgggctgtg
acaggcttccaacccaccgggcccaagggcctagagccaccagaagaggagcgtaaccca
tataaggaggtgtaccctgacgtctgggtggagccagaggcggcagcctacacaccccct
ccagccaaaaagcctcgcaaaagcacagcagccgagaaacccaaggtcaaggagatgatt
gacgaggggacgagagcgatcagggtttacccacttgttggttttaccactacgtctctg
gcttgcaccaattacattctgtctttctccacagacatctgcatctcctgtggaagtttg
aatgtttcccgtgaacaccctctgtttgctggaggaatgtgccagagctgtaagaactgc
tttctagaatgtgcatatcagtatgacgacgatggttaccagtcatactgcaccatctgc
tgtgggggacgagaggttctcatgtgtgggaacaacaactgctgcaggtgtttctgtgtg
gagtgtgttgacctactggtggggccaggcgcagcacagatagctattaaagaggatccc
tggtgctgctacatgtgtgagaagggccagaagggagtgttcggcctgctggagcgtcac
actgattggccctgccgtctacagcatttcttcgctaacaatcacgaccaagattttgaa
caaccaaagctttaccctccagtcatggcagagaagagacaacctattcgtgtcctgtca
ctgttcgacggcatagcaacaggtctgctggtgctaaaggagctgggtatccaggtggag
cgctacgtggcatcggaggtgtgtgaggactctatcacggtgggcatcgtcaggcatcag
ggacgcatcatgtacgtcggcgacgtgaggaacgtcacacgcaaacatttacacgagtgg
ggcccctttgacttagtgattggtggaagtccgtgtaacgacctctctattgtcaaccca
gctaggaagggtctttatgagggcactggtcggctgttctttgagttctaccgcctgctg
cacgaggctcggcccaaagagggcgacaaccggccgttcttctggctctttgaaaacgtg
gtggcaatgggcgtcagtgacaagagggacatctctcgctttctagagtgtaacccggtg
atgatcgatgccaaggaggtgactgctgcccaccgtgctcgctacttctggggcaacctg
cctggcatgaacagacccttgatggccatgttcactgacagactagaccttcaggactgt
ttggagcacggcagaacagcaaagtttggcaaagtgaggaccatcaccactcgctctaat
tccattaagcagggtaaagaccagcactttccygtcttcatgaacgagaaggaggacatt
ctttggtgcactgagatggagagggtgtttggcttcccagtccattacacagacgtgtcc
aacatgagtcggctggccaggcaaaggcttctgggaaggtcgtggagtgtaccggtcatc
cgacacttgtttgcaccactcaaagaatattttgcctgtgtttaa

DBGET integrated database retrieval system