KEGG   Salvelinus alpinus (Arctic char): 111963590
Entry
111963590         CDS       T05762                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111963590
   04012 ErbB signaling pathway
    111963590
SSDB
Motif
Pfam: EGF Laminin_EGF
Other DBs
NCBI-GeneID: 111963590
NCBI-ProteinID: XP_023842919
LinkDB
AA seq 155 aa
MMNRAFWDVIFLITGSLFTYGTGHDNSTIATNSTMTTTPPVITTAVNIMIFSTTTSTITT
TNLSVKKFVAAAVRSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHQGFVGMRCEHADL
LAVVATNHRQQTVATALVLCVIGCVLTMLLCTLLQ
NT seq 468 nt   +upstreamnt  +downstreamnt
atgatgaatcgggcattctgggatgtgatctttctcattactgggtccctctttacctat
ggaaccggacatgataattctactattgctactaattctactatgaccaccacccctcct
gtgattactaccgctgtaaacattatgatcttttctaccactaccagcaccattaccaca
accaacctttcagttaaaaagtttgtggcagcagctgttcgatcacacttcgatgactgt
cctgactcgcacagccacttctgtttccatggcacctgtcgtttcctgattctggaggag
acgcctgcatgtgtgtgtcaccaaggctttgtagggatgcgatgcgagcacgccgacctg
ctggccgtggtggccaccaatcacaggcaacagacagttgccacggcgctagtgctgtgt
gtgattggctgtgtcttgacgatgctgctctgtacacttttacagtaa

DBGET integrated database retrieval system