KEGG   Salvelinus alpinus (Arctic char): 111963856Help
Entry
111963856         CDS       T05762                                 

Gene name
lamc3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04510  Focal adhesion
salp04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111963856 (lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111963856 (lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF Laminin_B DUF1298 DASH_Dam1
Motif
Other DBs
NCBI-GeneID: 111963856
NCBI-ProteinID: XP_023843176
LinkDB All DBs
AA seq 1631 aa AA seqDB search
MVMDIPLTNPLLLAFLLCSLSFVHGAMDSCYDDDEGVPSRCMPKFENAAFNRTIMASNVC
GSPPEDYCMQTSSTRSCHHCSVSDMGLSHNASLLTDFHTDEEPTWWQSQSMFYRVQHPNS
VNLTLRLGKAFEITYVRLKFYTSRPESFAIYKRTNQDGPWMPYQYYSASCSKTYGKNAKG
YIRPGDDERMALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSAVLQEWVTATDLLIS
LDRLNTFGDEFFKDAKVLRSYFYAISDFSVGARCKCNGHGSECVLDEQGALVCDCQHHTA
GVDCQKCRPFYQDRPWARATGDSANQCMKCNCSGRADACVFDAEQYRSTGSGGRCVDCRE
HTDGPHCERCKENHYRRSPQDLCRPCDCNTIGSVSLQCGAEGMCTCRPSVTGEKCDTCQP
GFHSLSPGGCRSCDCETRGSVGICSTLDGGCHCKDNVEGQACDRCKPGSFNLQENNPAGC
TSCFCFGHSLACRSSNHHAAVNITSDFLEDPDRWSGQFSGGQEYPLLWKEGEVYLLPLSE
DDLGFYRAPEKFLGNHLLSYGQLLSLTFTAEAQCLLPHSVTVLLEGSGITLSADLSPQPE
LVHQPGLAPQHTFTLRLHKEETRLRPFLSAFEFQSLLFNITAFRISNAGGHNYTSQLSGV
TLASAAHSSSPVTSSTPPAPWVEVCTCPPGFGGQFCELCAPGYTREVPNRGPLSPCVPCT
CHQHGPCHHETGVCKCADFTTGPTCERCLDGYYGNALIGTTNDCQTCPCPDRTSCAQIME
IGDVVCTNCPLGQRGTRCELCEDGFHGDPLGRSGLVRQCERCDCNGNVDPNALGVCDHMT
GRCFKCLGHTEGDHCQRCRRGYYGDAMDRTMAGKCKPCDCSPAGTSGLLEDCDPQTGSCQ
CLSHVTGGDCGQCSVGFFNLQPGVGCERCNCNPIGSSSAGCHPITGQCVCRPGLEGRLCS
TCRMGFFGFSSRGCRACNCDPMGSSSMQCHTNGTCPCRQGFVGYKCDQCELNYFHNRATH
QCEECPICYGLVKEQAGKLKARLQDLEKLLARFDCRSGYGRQHHVREYHVRQHHERGHQG
EDSLPNALEDFLAIQEAKEAFVKQFALLELSTHTLSAQLHTVTTAMNCSASMEEEQEEGW
RTLCRTLADSESVVISARTQLMQATLDLDNMVIPFKVTPEPNRWNSAVNDSEILMKSHTE
MAGHIEAIATKAFMASNQTYSLLMDLLEDKSIEEYISNLTEQMADMQQMKENLTAQVNET
LANQLSLEEESAEIMVAFVNLTSSILELSKNMPNPTSGTNQSDPSLRAGANQSEGVELSN
RTSELAFHVQSKEELASKIREEMEPRIQTAHNNIAAVQDMHKLTVQAQGSKVIALSSVVT
GKEVESKAVTLRRELEDMQREWPQRQAQTNAALKRERLLREKVLEDVSKKVNQTKRVLRP
ALESATLSNATAQQAKHTANALSKEAKATLTQGKHTRTLSAQLSSSVDITLQQLAEQENH
TVHAQTQLNVEPVESLASVKVNIQTAKLQLEAYSLTLTQLVSKIDGSVALERFERILSET
AVRLSVLRGSVESPALNGKIQTLRSAAQDQKSQLTHLEQDLQEIRQERDSLKDIALHLPQ
TCPQASGIEGH
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggatataccactgaccaacccactcctcctcgccttccttctctgctccctc
tccttcgttcacggggccatggactcctgctacgatgacgacgagggcgtccctagccgt
tgcatgcccaagttcgagaacgcagcctttaaccgcacgatcatggcttccaatgtgtgc
ggttcaccgccagaggattactgcatgcagacgagctcgacgcgctcctgccaccactgt
agtgtgtcggacatgggcctcagccacaacgccagcctgctgacggacttccacacggat
gaggaacccacctggtggcagagccagtccatgttctacagagtccagcaccctaactct
gttaatctcaccctgcgcctcggtaaggcctttgagatcacctacgtgcggctcaagttc
tacaccagccgaccggagagctttgccatctacaagcggacaaatcaggatggaccatgg
atgccctaccagtactacagcgcctcctgtagcaagacctacgggaagaacgccaaggga
tatatccgcccgggggacgaygagaggatggcattgtgcaccgacgagttcagtgacatc
tcccctttgactgggggcaacgtggccttctctactttggagggacgacccagcgcatat
aactttgaccagagcgccgtgctgcaggagtgggtgacagccactgacctgctgatctct
ctggacaggctcaacactttcggagacgagttcttcaaggacgccaaggtgctgcgatcc
tacttctacgccatctctgatttctctgtgggagccaggtgtaagtgtaatggccatggc
agtgagtgtgtgttggacgagcagggggctctggtgtgtgactgccagcatcacactgcc
ggggtggactgccagaagtgccgaccgttctaccaggacaggccatgggccagggccacc
ggagactctgccaaccagtgtatgaagtgtaactgcagtgggcgagcggatgcatgtgtg
ttcgatgcggagcagtaccgtagcacagggagtggggggcgctgtgtggactgtagggag
cacactgacgggccgcactgtgaacgctgcaaagagaaccactaccgacggtcaccacag
gacctctgccgcccctgcgactgtaacaccataggttctgtgagtctgcagtgtggtgca
gaggggatgtgtacgtgcagacccagtgtgacgggggagaagtgtgacacctgtcaaccc
ggcttccactcgctcagccctggtggctgcaggtcgtgtgactgtgaaaccaggggcagt
gttggcatctgctctacactggacggaggttgtcactgcaaggataacgtggagggacag
gcgtgtgacaggtgcaagccaggctccttcaacttgcaggagaacaacccagctggctgc
acgtcatgtttctgcttcggacactcattggcctgcagatcctccaatcaccatgcggct
gtcaacatcacctctgacttccttgaagacccagaccgctggtctggacagttctctggg
ggacaggagtaccctctactgtggaaggaaggtgaggtctacctgctaccactcagtgag
gatgacctgggtttctacagagctccagagaagttcctggggaaccatctcctgagctat
ggccagctcctctccctgaccttcacggccgaggcccagtgcctcctccctcacagtgtc
accgtgcttctggaaggatctggaatcaccctgtcagctgacctttcaccccaacctgaa
cttgtccaccagccaggcctcgctccccagcacaccttcactctcagacttcacaaggag
gagacaagactgaggccttttctgtctgccttcgagttccaaagtcttctcttcaacatc
actgcattcaggatcagcaacgcaggaggacacaactacacgtcccaactctcaggggta
accctggcctccgctgctcactcctccagccctgttacctcctctaccccccctgctccc
tgggttgaggtgtgtacgtgccccccggggtttgggggtcagttctgtgagctgtgtgcc
ccaggctacaccagagaggtccctaacagaggacccctgtcaccctgtgtgccctgcacc
tgccaccagcacggaccctgccaccatgagacaggtgtgtgtaagtgtgccgatttcacc
acaggaccaacctgcgagcgctgcctggatggttactatggcaacgcgctgattggcacg
accaacgactgtcaaacttgcccctgcccggaccgcaccagctgtgctcaaattatggag
attggggacgtggtctgtaccaactgccctttgggacagaggggaaccaggtgtgagttg
tgtgaggacggtttccacggcgaccccctgggccgttctgggctggttcggcagtgcgag
cggtgtgactgtaacggtaatgtggaccccaacgcgctgggcgtgtgtgatcacatgacg
ggccgctgcttcaagtgtctgggacacaccgagggagaccactgtcaacgttgtcgacgc
ggttactatggagatgccatggaccggacgatggccgggaagtgcaaaccctgcgactgc
agtcctgcagggacttctgggttgttggaggactgtgacccccagaccggaagttgtcag
tgccttagtcatgtgaccgggggagactgtggccagtgttcagtcggcttcttcaacctg
cagcctggagtaggctgtgagaggtgcaactgtaacccaattggctcgtcttccgcgggg
tgccacccaatcacagggcagtgtgtgtgtcggccgggactggaggggcgcctgtgcagc
acctgtcgtatgggcttctttggtttctcctcacgaggctgcagagcctgtaactgcgac
cctatgggctccagctccatgcagtgccacacaaacggcacctgtccctgccgccagggc
ttcgtggggtacaagtgtgaccagtgtgagctcaactacttccacaacagagccacgcac
cagtgtgaagagtgccccatctgctacgggctagtcaaggagcaggcagggaagctgaag
gcacggctgcaggatttggagaagctcctggcacgcttcgactgccggagtggctacgga
cgccagcatcacgtgcgcgagtatcacgtgcgccagcatcacgagcgtggccatcagggg
gaggacagcctgcccaatgcgctggaggacttcctggctatccaagaggcaaaagaagcc
tttgtcaaacagtttgctctcctggagttgtcgacacacactctctcagcccagctgcac
actgttaccacagctatgaactgtagcgccagcatggaggaagagcaggaggaagggtgg
agaacattgtgcaggacccttgctgactctgagtcagtggttataagtgcacggacccag
ctgatgcaggcaactctggacctggacaacatggtcattcctttcaaggtgacaccagag
cccaaccgctggaactcagcagtgaacgattcagagatacttatgaaaagtcacacagag
atggctggtcatatagaggctatagcgaccaaggctttcatggcctccaaccagacctac
tctctcctgatggacctactggaggacaagtctattgaggaatacatcagcaacctcacg
gagcaaatggcagacatgcagcagatgaaggagaatttgacggcccaggtgaatgagact
ctcgccaatcagctgtctctggaggaggagtctgctgagatcatggttgcctttgttaac
ctcacatcctccatattggagctgtccaaaaatatgcccaaccccacatcaggaaccaac
caatcagaccccagcctcagagcgggtgccaaccaatcagagggtgttgagctgagcaac
aggacatctgagctggcgttccacgtccagtctaaagaagagctggccagtaagatcaga
gaggagatggagcctcgaatacagaccgcccacaacaacattgctgccgtacaggacatg
cacaagctgacagttcaagcccaggggtcaaaggtcattgccctgtcatcggtggtgaca
gggaaggaagtggagtcaaaggccgttaccctgcggagagaactggaagacatgcagaga
gagtggcctcaaaggcaggcccagacgaacgctgctctgaagagggagaggctgctgagg
gagaaggttctggaagacgtcagtaagaaggtgaaccagaccaagcgagtccttaggcct
gccttggagagcgctaccctctccaacgctaccgcacaacaggcaaaacacaccgcaaac
gccctgtctaaagaagccaaggccaccctaacccagggcaagcacacaaggacattgtct
gcccagctcagctcatctgtagacataaccctgcagcagctggctgagcaggagaaccac
actgttcacgcacaaacccagctaaatgtagagcctgtagagtctctggccagtgtaaag
gtgaacatccagacagctaagcttcagcttgaggcctactccctcacactcacccagctc
gtcagtaaaatagatgggagcgtggcgctggaacggtttgaacgtatactgagtgagacg
gcggtgcggctgagtgttctgcgtggcagcgtggagagcccggccctgaacgggaagatc
cagaccctacgatcagccgcccaggaccagaagagccagctgacccaccttgaacaggac
ctgcaggagatcagacaggagagagacagtctgaaggacattgccctgcacctgccccag
acctgccctcaggcctcggggatagagggacactag

DBGET integrated database retrieval system