KEGG   Salvelinus alpinus (Arctic char): 111964018Help
Entry
111964018         CDS       T05762                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04012  ErbB signaling pathway
salp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111964018
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111964018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111964018
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111964018
Protein kinases [BR:salp01001]
 Non-receptor tyrosine kinases
  ABL family
   111964018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase Caskin-Pro-rich
Motif
Other DBs
NCBI-GeneID: 111964018
NCBI-ProteinID: XP_023843434
LinkDB All DBs
AA seq 1099 aa AA seqDB search
MGQQPGKFVGDQRRPSLPALNFIKGGKRESSRHGAHHCNVFAVHEALQRPDFEPQGLTEA
ARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTN
HGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISL
RYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTI
YGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLK
EAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLYMAT
QISSAMEYLERKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKW
TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMDRPEGCP
EKVYQLMRACWKWNPVERPSFAETHQAFETMFQESSISDEVEKELGKKGKKVTLGPIQQA
PQLPTKTRTLRRNVDRDGDSPDAVEPEVAVSPMLPRKERPFLDSNLNEDDRLLPKDKDKS
RNSLFNLIKKKKKTAPAPPKRSSSFRDMDGHAERLGLAPDPRDDFNNVSSAFSVTHTIDP
SKFPSANNNGVGGITNGGPTYPGPLFPPHHARKKGTPVVPSVVGKTATTPPNEEDIVSNS
KRFLRSSSASSMPPGSERTEWKSVTLPRDLHKGHFDSGTFRSKPALPRKRANEKPEISAP
RMGTLTPPPRLPKKTEDMSDEVFKDTEPSLLTPKLGRRLLGLGVDSSKTSALQAELLKPN
VFPALGAAGDECRARRHKPNLDSSGPRERGKFQKTKPAPPPPPSAKISRSPTHELPSSTD
AKAKASDPHYPSSFSDQVRSPLEAHKKLNLNTSSKPQPLKTSSSSVSGSTSSPLGFTSLN
SPGDQASPTAFIPLMNTRRSLRKTRALPERQPNSAITREMVLEGTELLRTAIGRNSEQTG
SHSAVLEAGKNLSKYCVSYVDSIQQMRNKFAFREAINKLESSLRELQICPAATGGVSGAQ
QDFSKLLSSVKEISDIVQR
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagccggggaaatttgttggggaccagaggagaccgagtctgccagcgctg
aatttcatcaagggagggaagagggagtcatcacggcatggagcccatcactgtaacgtg
ttcgccgtgcacgaagctctccagagaccagactttgagccccagggtctgaccgaagcg
gcccgctggaactccaaagaaaatcttttggccggacccagcgagaatgaccccaacttg
tttgttgctctttacgactttgtggccagtggggacaacactctcagcataactaaagga
gagaagctgcgagttttgggttacaaccataatggggagtggtgcgaggcgcagaccaac
cacggccagggctgggtgcccagtaactacatcaccccggtcaacagcctggagaagcac
agctggtaccatgggcctgtgtcgcgcaacgcagcagagtacctgctcagctcgggcatc
aacggcagcttcctggtcagggagagcgagagcagccccgggcagaggtctatctcactg
cgctacgagggacgagtctaccactacaggatcaacacagcctccgacgggaagctatac
gtgtcgtctgagagccgtttcaacaccctggcagagctggtgcaccaccactccacggtg
gctgacggcctcatcaccacgctgcactacccagcgcccaaacgcaacaagcccaccatc
tacggcgtgtcacccaactacgacaagtgggagatggagcgtacagacatcaccatgaag
cacaagctgggaggagggcagtatggggaggtctacgagggggtctggaagaagtacagc
ctcactgtggccgtcaagaccctcaaggaggacaccatggaggtggaggagttcctgaag
gaggctgctgtcatgaaggagatcaaacaccccaacctggtacagctactgggcgtgtgc
acgcgggagcccccgttctacatcatcacagagttcatgacccatggcaacctgctggac
tacctgagggagtgtaacagggaggaggtgaacgctgtggtgctgctctacatggccacg
cagatctcctccgccatggagtacctggagaggaagaacttcatccacagggacctggca
gcccgtaactgtctggtaggggagaaccacctggtgaaggtggcagactttgggctgagc
aggctgatgacgggggacacgtacacggcccacgctggggccaagttccccatcaagtgg
actgccccggagagcctggcctacaacaagttctccatcaaatctgacgtctgggcgttc
ggagtgttgctatgggagatcgccacctatgggatgtctccgtaccctggcatagacctc
tcccaggtgtatgagcttctagagaaggactaccgcatggaccggccagagggctgccca
gagaaggtctaccagctgatgagggcctgctggaagtggaaccctgtggaaaggccctcc
tttgcagagacccaccaggcctttgagaccatgtttcaggaatccagcatctctgacgag
gtggagaaggagctggggaagaaagggaagaaggtgacactgggccccatccaacaggct
ccacagctgcctaccaagaccaggaccctccgtaggaatgtggacagagacggagacagc
cctgatgccgtggagccagaggtggccgtgtcccccatgctcccaaggaaagagcgtccg
ttcctggacagcaacctgaacgaggatgaccgcctactgcccaaagacaaggacaagtcc
cgcaacagcctcttcaacctcatcaagaagaagaagaagactgcgcccgccccgcccaaa
cgcagcagctctttcagggacatggacggacacgcggagagactggggctagcgcccgac
ccccgagacgacttcaacaacgtctcctcagccttcagtgttactcataccatcgacccc
agcaagttcccgagtgctaacaacaatggggtagggggtattaccaacgggggccccacc
tacccaggccccctgttccccccacatcatgccaggaagaaaggtacgccggtagtgccc
agtgtagtgggtaaaacagccaccaccccacccaatgaggaggatatagtctctaactcc
aagcgtttcctgcgctcctcctcggcctctagcatgcccccgggctcggagcgcactgag
tggaagtcagtcacgctgccacgcgacctgcacaaaggccactttgactcgggcaccttt
aggagcaagcccgccctgccacgcaagagggccaatgagaagccagagatcagcgcccct
cgcatgggcaccctgacccccccaccccgcctgcccaagaagacagaggacatgtcagac
gaggtgtttaaggacactgagcccagcctcctgacgcccaagcttggcagaaggcttcta
gggttgggggtggacagctccaagaccagcgccctgcaggctgagctgctcaagcccaac
gtgttccctgctttgggggcagccggggatgagtgcagggcccgccgccacaaacccaac
ctggactcctccggccccagggagagaggcaagttccagaagaccaaacctgctccccct
ccaccccccagtgccaagatctcccgcagccccacccacgagctcccctcatccacagat
gccaaagccaaggcctcagacccccactacccatctagcttcagtgaccaagtccgctct
cctctggaggcccacaagaaactcaacctcaacacctcctccaaaccacagccattaaag
acctcctcctcttcagtgtctggctctacctccagccccctgggcttcacctccctcaac
tccccaggagaccaggcctctcccacagcctttatccccttgatgaacacccgccgctcc
ctgaggaagactcgtgcactcccggagcgccaacccaactcggccatcaccagggagatg
gtcctggagggcacggagctgctgcgcaccgccatcggacgcaactctgagcagacaggc
agccacagcgccgtgctggaggcgggcaagaacctgtccaagtactgcgtaagctatgtg
gactccatccagcagatgaggaacaagtttgccttccgcgaggccatcaacaagctggag
agcagtctgcgtgagctgcagatctgccctgctgccaccgggggcgtcagcggagcgcag
caggacttcagcaagctgctgtcgtctgtcaaagagatcagtgacatcgttcagaggtag

DBGET integrated database retrieval system