KEGG   Salvelinus alpinus (Arctic char): 111966441Help
Entry
111966441         CDS       T05762                                 

Definition
(RefSeq) peptidase inhibitor 15-like
  KO
K20412  peptidase inhibitor 16
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:salp04090]
    111966441
CD molecules [BR:salp04090]
 Proteins
  111966441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP PAP2
Motif
Other DBs
NCBI-GeneID: 111966441
NCBI-ProteinID: XP_023846834
LinkDB All DBs
AA seq 326 aa AA seqDB search
MLRGTLLWAGLVGFYVIVTLCPXSCQLSEDDTETLVELHNSYRGQVVPNSTYMQKVKWDE
KLKIIAEGYAVKCIWEHNPDLEELNMGENLFVSNGLFDPNIAMEKWFLEHLDYDYNNNSC
QDDKMCGHYTQMVWADSHSVGCAVHRCDTMEGLSFEKATFLVCNYYPAGNFNDEKPYEEG
EWCSKCPDNLPRCDQNLCVPDAHEPTEEPDVEKETMYSSLPGTDEPSTHTATATATTIAT
ATEDTPPSPPRTQPDYSSAPEPTMADREETGTEPGDEEEEEKWEGEERATEREKDSTREQ
PPANAGSVSTSLLLVTSLMPLLSLGL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgagggggacacttctctgggctggcctggtgggattctatgtcattgtcaccctg
tgtccagsctcctgccagctgagcgaggacgacacagagaccctcgtggagctgcacaac
agctaccgtggccaggtggtgcccaattccacctacatgcagaaagtgaaatgggatgag
aagctgaagatcatagctgagggctatgctgtgaagtgtatatgggagcacaacccggat
ctagaggagctgaacatgggagagaacctgtttgtgtccaacggactctttgaccccaac
attgccatggagaagtggttcctggagcacctagactacgactacaacaacaacagctgc
caggatgacaagatgtgtggacactacactcagatggtgtgggcggactctcactctgtg
ggctgtgctgttcatcgctgtgacaccatggaggggctgtcctttgagaaagccaccttc
ctagtctgcaattattacccagcaggtaactttaatgatgagaaaccctatgaggaaggt
gaatggtgctccaagtgtccagacaacctgccgcgatgtgaccagaacctctgtgtgcct
gatgcccatgagcctacagaggagcctgatgtagagaaggagacaatgtacagctctctc
ccaggcactgatgagccctccacacacacagccacagccacagccaccaccatagccaca
gccaccgaggacacaccgccatcaccaccgaggacacaaccagactactcatcagcccct
gagccaaccatggctgacagagaggagacaggcacagagcctggggatgaggaggaggag
gagaagtgggagggggaggaaagagctacagagagggagaaggacagtactagagaacaa
cctccagccaacgcaggaagtgtttctacttccctacttctggttactagcttgatgcct
ttactgtcactgggattgtga

DBGET integrated database retrieval system