KEGG   Salvelinus alpinus (Arctic char): 111967172
Entry
111967172         CDS       T05762                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04012  ErbB signaling pathway
salp04068  FoxO signaling pathway
salp04110  Cell cycle
salp04115  p53 signaling pathway
salp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111967172
   04068 FoxO signaling pathway
    111967172
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111967172
   04115 p53 signaling pathway
    111967172
   04218 Cellular senescence
    111967172
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111967172
NCBI-ProteinID: XP_023847803
LinkDB
AA seq 189 aa
MDRPFPEIRHSFNAMIVFSATGSLTRTTMASCKCILSSPEKSPARQNLFGPVDHEQLQQE
YQDTLRRDLEDACRRWGFDFLSDKPLAGRDFQWEEVPGTMVPLLYLPCLLGQGEAQKIGG
PAASTGMVRAGPWHRGKENIPCTPEKNGANLQNLEKPQDENKLKRKQTNLTDFYQAKKRV
VGTSLKSGR
NT seq 570 nt   +upstreamnt  +downstreamnt
atggaccgcccattcccagaaattcgtcactcgttcaacgcgatgattgtgttttcagcc
actggtagcttaaccagaacaaccatggccagttgtaagtgcatcctgagctctccggag
aaaagtcctgccaggcagaacctgtttggcccagttgaccatgagcagctgcagcaggag
tatcaggacaccctgcgcagagacctggaggacgcctgtcgccgctggggcttcgacttc
ctgtcagataagcctctggctgggcgagacttccagtgggaggaggttccgggcaccatg
gtgcctctcctctacctgccctgcctgttgggtcagggggaggcacagaagatcggaggg
ccggcagcatccacagggatggtcagggcggggccatggcaccgtggcaaggaaaacatc
ccttgcacccctgagaagaacggagccaacctccagaacctggagaaaccgcaagacgag
aacaaactgaagaggaaacagaccaacctcacagatttctaccaagccaagaagagagtg
gtgggtacgtcgcttaagtcaggccggtga

DBGET integrated database retrieval system