KEGG   Salvelinus alpinus (Arctic char): 111969790
Entry
111969790         CDS       T05762                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
salp  Salvelinus alpinus (Arctic char)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2 Ribosomal_L6e
Other DBs
NCBI-GeneID: 111969790
NCBI-ProteinID: XP_023851816
LinkDB
AA seq 279 aa
MTDTVSGSDKSLSFEKTWGSSTSSGYYSGDSDSEFEQYFTARTSFLHKPKKEKDEQVEWG
KQQDLSVTEIQQKVKEYNAQINSNLFMNLNKDGSYTGFIKVQFKLLRPVSVPPPRKGTAT
QDGAGKKTGGVKRRTSFYLPKDTSKHLHISSRTCAREVIEALLKKFTVVDNPGKFALFER
TKRHDQVFLRKLPDDERPLHLRLCAGPNDKALSLVLKENETGEVNWDAFSMPELKNFVRM
LQREEEEHVKQIVQRYALARTRMQEAQAASPTPGGSTPG
NT seq 840 nt   +upstreamnt  +downstreamnt
atgacagacacggtcagcggttcggataaaagcctgtccttcgagaagacgtggggcagc
tcgactagcagcggatactacagtggggactccgattcagagttcgagcagtacttcact
gctcgcacatcattccttcacaaacccaagaaggagaaggatgaacaggttgaatggggg
aagcagcaggatctgtcagtcacagagatccagcagaaggtgaaggagtacaatgctcaa
atcaacagcaacttgttcatgaacctgaacaaagatggctcctacactggcttcataaag
gtccagttcaagctgctacgacccgtgtcagttcccccaccaagaaagggtactgcaaca
caggatggtgcaggcaagaagactgggggagttaagcgtcgcacctctttttacctgccc
aaggatacgtccaaacacctacatatcagctcccgcacatgtgctcgtgaggtcatcgaa
gccttgctgaagaagttcaccgtggtggacaaccctggaaagtttgctttgtttgagcgc
acaaagcgccatgaccaagtattcctgcgtaagctgcctgacgacgagcgtccactccac
ctgcgtctgtgtgctggacccaatgacaaagccctcagtttggtcttgaaagagaatgag
actggagaggtcaactgggatgccttctctatgccagagctcaagaactttgttcgcatg
ttacagcgtgaggaggaggagcatgtcaagcagatagtgcagcgctacgcactagcccgc
accaggatgcaggaggcccaagctgctagtcccacccctggtggttccacccctggctga

DBGET integrated database retrieval system