KEGG   Salvelinus alpinus (Arctic char): 111970032
Entry
111970032         CDS       T05762                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
salp  Salvelinus alpinus (Arctic char)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 Adeno_E4_34
Other DBs
NCBI-GeneID: 111970032
NCBI-ProteinID: XP_023852288
LinkDB
AA seq 376 aa
MSWGEFIELRELRLHDNDRIELTSCEVPRSPPRLERANALRISPGKVPELLSRVGIIRLL
GDSLDPRLTDERGEGHDFQPCSHAQPTWCDLCGDFIWGLYKQSLRCANCGFTCHYRCRPL
IQLDCSLDRGSTVEQTCAVETDTNVDEQIKCGKQQELSGTEIQQKVKEYNAQINSNLFMN
LNKDGSFTGFIKVQFKLVRPVSVPPPRKGTATQDGAGKKNGGVKRCTSFYLPKDTSKHLH
ISSRTCAREVIEALLKKFTVVDNPGKFALFERTERHDQVFLRKLSDDERPLELRLCAGPN
EKALSLVLKENETGEVNWDAFSMPELKNFVRMLQREEEEHVKQILQRYALARTRMQEAQA
AASIPGGSSASGSTPG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcttggggtgagttcattgagctccgtgagttgaggctgcatgacaatgaccggata
gagctgaccagctgcgaggtgcctcgctcaccacctcgcctggagcgggccaatgccctg
cggatcagcccagggaaggtccctgagctgctcagccgagtgggcatcatccgactgctg
ggggatagcctggacccacggctcacagatgagaggggagagggacatgacttccagccc
tgcagccatgcccagcccacctggtgtgacctgtgtggagacttcatctggggactgtac
aaacagagcctgcgctgtgccaattgcggattcacatgtcactatcgatgtcgacctctc
atccaattagattgcagtttggatcgtggctccacagttgaacaaacatgtgctgtagag
actgatacaaatgtggatgagcagatcaaatgtgggaagcagcaggagctgtcaggcaca
gagatccagcagaaggtgaaggagtacaacgctcaaatcaacagcaacctctttatgaac
ctgaacaaagatggctccttcactggcttcataaaggtccagttcaagctggtacgacct
gtgtcagttcccccaccaagaaaaggtactgcaacacaggatggtgcgggcaagaagaat
gggggagtaaaacgttgcacctctttctacctgcccaaggatacatccaaacacctacac
atcagctcccggacatgcgctcgtgaggtcatcgaagccttgctaaagaagttcactgtg
gtggacaaccctggaaagtttgccctgtttgagcgcaccgagcgtcatgaccaagtgttc
ctgcgtaagctgtctgatgacgagcgtccactcgaactgcgtctgtgtgctggacccaat
gagaaagccctcagtttggtattgaaagagaatgagactggagaggtcaattgggatgcc
ttctctatgccagagctcaagaactttgtccgcatgttacagcgtgaggaggaggagcat
gtcaagcagattttgcagcgctacgctctggcccgcaccagaatgcaggaggcccaagct
gctgcttccatccctggtggttcctccgctagtggttccacccctggctga

DBGET integrated database retrieval system