KEGG   Salvelinus alpinus (Arctic char): 111970063
Entry
111970063         CDS       T05762                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04012  ErbB signaling pathway
salp04068  FoxO signaling pathway
salp04110  Cell cycle
salp04115  p53 signaling pathway
salp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111970063
   04068 FoxO signaling pathway
    111970063
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111970063
   04115 p53 signaling pathway
    111970063
   04218 Cellular senescence
    111970063
SSDB
Motif
Pfam: CDI PMSI1 DUF2576
Other DBs
NCBI-GeneID: 111970063
NCBI-ProteinID: XP_023852326
LinkDB
AA seq 150 aa
MASRKRILSSLGKGPARRNLFGPVDHEQLQQEYQNALRRDLEDACHRWGFDFLSEKPLAG
GDFQWEGVLGTKLPLLYQPCLLGQGEAQREGGLTAITGGVRAGPLHRGKENIPCTPEKCG
ANHQNLEKTPDKKENTNLNENRLKTKQTED
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccagtcgtaagcggattctgagctccctggggaaaggtcctgccagacggaacctg
tttggcccagtggaccatgagcagttgcagcaggagtaccagaatgccttgcgcagagac
ctggaggacgcctgccaccgctggggctttgatttcctgtcagagaagcctctggctggg
ggagacttccagtgggagggggttctaggcaccaagctgcctctcctctaccaaccctgc
cttttgggtcagggagaggcacagagggagggaggcctgacggccatcacagggggggtc
agggcagggccattgcaccgtggcaaggagaatatcccttgcacacctgagaagtgcgga
gccaaccaccagaacctggagaaaacaccagacaagaaggagaacacgaacctcaatgaa
aacagactgaagacgaaacagaccgaagactaa

DBGET integrated database retrieval system