KEGG   Salvelinus alpinus (Arctic char): 111972315
Entry
111972315         CDS       T05762                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04020  Calcium signaling pathway
salp04144  Endocytosis
salp04510  Focal adhesion
salp04540  Gap junction
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111972315 (pdgfra)
   04020 Calcium signaling pathway
    111972315 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111972315 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111972315 (pdgfra)
   04540 Gap junction
    111972315 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111972315 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111972315 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:salp04090]
    111972315 (pdgfra)
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111972315 (pdgfra)
Protein kinases [BR:salp01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111972315 (pdgfra)
CD molecules [BR:salp04090]
 Proteins
  111972315 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Receptor_2B4 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 111972315
NCBI-ProteinID: XP_023855077
LinkDB
AA seq 1466 aa
MDEMKTCLIIGVVLFGLLSVTCGLMPPTIVSTEDEFVLEPLSVFNISCTSKRTVAWVEPL
PVNTFVLPGYYTATLFIYNASVTHTGYYTCIYQDKEGDEEYDEDNEAVIYVFVPDPNVPF
VPEEPGSMVVLVYPGETIIPCRVSDPHSPVVLKSAPSGVEVDAAYDNKIGFIGNLDAGLY
VCETTVNGVTTTSDIYTVKDNKLMEDFHVEVKASEEAVRLGEPFNITCVAPPGLPYQQQW
LHPRKQAVDAVQMKQTLPDRVVYTLSIPAASSQDSGVYECSITNNFNGEIRANMVAVTVF
EENSFVMLDHSGIGAVEFVSMMEETEFTISIEAFPAPKVTWLKDGITITENSYFLTKTRR
LVGNHYQSTLTLRQSLEKDSGNYTIIVLSSAHTAQFSFTLKVKESGPVLFQPASAPVLFP
QREEWIVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFITTVTVENATAGHTGFY
ICFYKGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPYGNHVLNGHDEMEIQCRVSDPGANV
TLVNADTQQAVPMAVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVHGWAGGSELHV
ELKAQKTALLVGDTITVICVARGSEILEDHWKYPGKLAARGLKSVRENKRDQEIQYTLTV
PQASAKDSGIYVCSITDIISNENQTKKLAITVYERPFVSLRPAFSSQESADLDEVRQFQA
DIDSFPSAQVTWLKDGLPLNDVAAEITTSLRQVSETRYQSVLTLIRAKEEDSGNYTIRVQ
NGNQTHSHNFSLQVKVPAVIVDLKDLHHGSATGQSVVCIAGGMPTPEVEWFICKNIKHCA
NDSSQWVPLPTNNTEITVEAHMDQDKQLESRVIFGHLENTLAVRCLARNEMAAVSREVKL
VSQDPHSELTVAAAALVLLVFVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVD
PMQLPYDSRWEFSRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSS
EKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYLHKNRENFISV
HPEKTKKDLDIFGINPADESSRSYVILSFESGKGDYMDMKQADTTQYVPMLEMSDASKYS
DIQRSEYNHPPSQKGDSEMDNMLSGDGNEGLSTTDLLSFTYQVARGMEFLSSKNCVHRDL
AARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTLSDVW
SYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPADVYEMMMKCWNSEPEK
RPSFFSLSESVASLLPSGYKRCFERVNHEFLKSDHPAVTRVQVENDDTYVGITYKNQGKS
KDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYCKRNRHSSQTSEESAIETGSSSTLAKR
EGETLEDITLLDEMCLDSELVEDSFL
NT seq 4401 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagacatgtctcatcattggggtggtcttgtttgggttgttatcagtt
acctgcggactgatgccaccgaccattgtatcaactgaagatgagtttgttctcgagcca
ctctccgttttcaacatcagctgcactagtaaaaggaccgttgcttgggtcgagccctta
cccgtcaacacatttgttttgcctggatattacacggccacgctcttcatctataacgct
tccgtgacacacaccggatattacacctgcatataccaagacaaagagggcgatgaagag
tatgatgaagacaatgaggcagtcatatacgtttttgtcccagatcccaatgttccgttc
gtgcctgaggagccaggtagcatggtagttctagtctatcctggtgaaaccatcatccca
tgcagggtgtcagaccctcactccccggtggtcctgaagagtgctcccagtggagtagag
gtggacgctgcttatgacaacaagatcggcttcattggcaacctggacgctggactctac
gtctgtgagaccaccgtgaacggcgtgacaacgaccagtgacatctacaccgtgaaggac
aacaaactgatggaggacttccatgtggaggtgaaggccagcgaggaggcagtgagactg
ggggaacccttcaacataacctgtgtggcacctccaggactgccctaccagcagcagtgg
cttcaccccaggaaacaggctgtggatgcagtccagatgaagcagactctgcctgataga
gtggtctacactctcagtatcccagcagcctcctctcaggacagtggggtgtatgagtgc
tctatcaccaacaacttcaatggagagatcagagccaacatggtggctgtcactgtcttc
gaggagaactcctttgtgatgttggaccacagtgggatcggagcggtggagtttgtcagt
atgatggaggagacagagttcaccatcagtattgaagccttccctgctcctaaagtcacc
tggctgaaagacggtatcaccatcactgagaacagctacttcctcaccaagaccagacgt
ctggtgggcaaccactatcagagcactctgactcttcggcagtcactagagaaggacagt
gggaattacaccatcatagtcctcagcagcgctcacactgcccagttctccttcaccctc
aaagtgaaagaatcagggccagtactgttccagccagcctcagcgccagtgctgttcccc
cagagagaggagtggattgttcccctccacacccccttcaccctgacctgcagaggcgag
gcagagctggcctgggacacgcccgtgtacctatcagagcagaccgaggaggacaacagc
ggcctgttcatcaccacggttaccgtagagaacgcgacagcagggcacactggcttctac
atctgcttctacaaaggagggaactccactgaggagggagaggacagcagcatctacata
tatgtgccagatccagaggtgcccttcgtaccctcgctggtgccctatggcaaccacgtc
ctgaatggtcacgatgagatggagatccagtgccgcgtgtcggaccccggtgccaatgtg
accctggtcaacgctgatacccagcaggccgtgcccatggcggtctacgacagcaagagg
ggtgccgtgggcttcttcagcgcaggaacctacgtctgtaaggccctcgtcaacggagag
gagcacctcagtgaggagtacattgtccacggctgggcaggggggtcggagctgcatgtg
gagctgaaggcccagaagacagccctcttggtgggagacaccatcactgtcatttgtgtg
gcccgggggtctgagatactggaagaccactggaagtaccctggaaaactggcggcccgg
ggcttgaagtcggtgcgtgagaataagagggaccaggagatccagtacacattgactgtc
ccccaggcctcagccaaagacagcggcatctatgtctgctccatcactgacatcatcagc
aacgagaaccagaccaagaagctggccatcactgtctatgaaaggccattcgtgtcgctg
cgcccggcgttcagttcacaggagtcagcagatttggatgaggtcagacagttccaggct
gacattgactcctttcccagcgctcaggtcacatggctcaaagatggcctccctctcaac
gacgtggcagctgagataaccaccagcctccggcaggtcagcgagaccaggtaccagagt
gttctgaccctgattcgggccaaagaggaggacagtgggaactacaccatcagagtgcag
aacgggaaccagacccacagccacaacttcagcctgcaggtcaaagtgcctgcagtcatt
gtggacctgaaggacctccaccatggctcagccacaggccagtctgtagtgtgtatcgct
ggaggcatgcccactcctgaagtggagtggttcatctgcaagaacataaaacactgtgcc
aacgactcgtctcagtgggtgcccctgcctaccaacaacacagagatcactgtggaagcg
cacatggaccaggacaaacagctggagagtcgagtgatctttgggcatctggagaacacc
ttggccgttcgctgcctggccaggaacgagatggccgccgtcagcagggaggtcaaactg
gtgtcacaagaccctcactcagagctgactgtagctgctgctgccctggtgctgctggtc
tttgtcatcatctcactcattgttctggtcattatctggaaacagaagcctcgctatgag
atccgttggagggtgatagagtcagtgagccctgatggccatgagtacatctacgtggac
cccatgcagctaccctatgactccagatgggagttctctcgcgatgggctcgtactggga
cgtatcctgggctctggggcgtttgggaaggtggtggagggaactgcatacggactcagc
cgctcccagcccgtcatgaaggtggccgtgaagatgctgaaacccacggcccgctccagt
gagaaacaggccctgatgtcagagctgaagatcatgactcacctgggccctcacctcaac
attgtcaacctgcttggggcctgtaccaagtcaggccccacctacatcatcactgagtac
tgcttctatggagaccttgtcaactacctgcacaagaacagagaaaacttcatcagcgtg
cacccagagaagaccaagaaagacctggacatctttggcatcaaccctgcagacgagagc
agcaggagctatgtgatcctgtcctttgagagtggtaaaggggactacatggacatgaag
caggcagacaccacgcagtatgtgcccatgctggagatgagtgatgcctccaagtactcc
gacatccagaggtccgaatacaaccacccgccatcacagaagggtgatagtgagatggac
aacatgctgtcaggggatggtaacgagggcctcagcaccacagacctgctcagcttcacc
taccaggtggccagaggcatggagttcctatcctctaagaactgtgtgcatcgggacctg
gctgccaggaatgtcctgctctctcaggggaagatagtaaagatctgtgactttggcctg
gccagagacatcatgcacgacaacaactacgtctccaaaggcagcaccttcctgccagtg
aagtggatggctcctgagagtatctttgacaacatgtacaccaccctaagtgacgtctgg
tcctacggcatcctcctctgggagatcttctctctaggtggcaccccatacccagggatg
gtagtggactccagcttctacaacaagatcaagagtggctacaggatggccaaacctgag
cacgcccccgctgatgtgtatgagatgatgatgaagtgttggaatagtgagcctgagaag
aggccttccttcttcagcctgagtgagagcgtggcctcactgctgccttccggctacaag
aggtgtttcgagagggtgaaccatgagttcctgaagagtgaccacccggcagtgaccagg
gtccaggtggagaatgacgacacctacgttgggatcacctataagaaccagggcaagtcg
aaagacagggagagtggcttcgacgagcagcgcctcagctctgacagtggttacatcatc
cccctccctgacctggaccccctgtctgatgacgagtactgcaagaggaatcgccacagc
tctcagacgtctgaggagagtgccatagagacgggctccagctccacgctggccaagaga
gaaggagagaccctggaggacatcaccctattggatgagatgtgtctggactcagagctg
gtggaggacagctttctgtga

DBGET integrated database retrieval system