KEGG   Salvelinus alpinus (Arctic char): 111974060Help
Entry
111974060         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: MARVEL domain-containing protein 3-like
  KO
K21099  MARVEL domain-containing protein 3
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04530  Tight junction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111974060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:salp02000]
    111974060
Transporters [BR:salp02000]
 Other transporters
  Pores ion channels [TC:1]
   111974060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL DUF4328 MIG-14_Wnt-bd
Motif
Other DBs
NCBI-GeneID: 111974060
NCBI-ProteinID: XP_023857341
LinkDB All DBs
AA seq 334 aa AA seqDB search
MPERSRYQERDEYDKSRERDCTHDRGSSSHEERDRERKREGDRRKRDKMDERYRDEKASG
DDRRVREKDYSDRQRDMTPHSHKDAPPDHRGSSQQGQQRAYTEASTCPSVGEYYEPQHRQ
ALYNLRYALTARGLCQIMEVFVNLLIVICSGVSYSNSGGYRDLASFGGIYHYYYGGAQAF
TGADADRVKELDKLFHQLKLPPYIFSMACGGALMVYACIILAFGVLRVPYRWPPVLLGEA
LVNLLIGLGYIPALAFYFIKLQETYDNPICTEREALYKSKGHQGFACALNGADIAGGLFG
VLGVIVFIFGMVLAIRAFRAVREMKRRAMEDGNL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgccagagagaagcagataccaggagagggatgagtatgacaagagcagggagagggac
tgcactcatgaccgaggaagctcctcacatgaagagagagaccgggaaaggaaaagagag
ggagaccggcggaagagagacaaaatggatgagagatacagggatgagaaggcctctgga
gatgacaggagggtcagagagaaggactactctgacagacagcgggatatgacaccccac
tctcacaaggacgcaccacctgaccacagaggcagtagtcaacaaggacaacagagagcg
tatacagaagcctccacatgtccctctgtgggggaatactatgagccacaacacagacag
gctctgtacaacctcagatatgccttaacagccagaggtctatgccagataatggaggtc
tttgtaaacctgctgatagtcatctgctccggagtgtcctacagtaactccgggggttac
cgggacctggccagcttcgggggtatctaccattactactatggaggagcacaggctttc
actggagccgacgcagacagggtcaaggagctggacaaactgttccaccagctcaagctg
cctccatacatcttcagcatggcctgtggaggggctctgatggtttatgcctgcatcatt
ctggctttcggggttctgagagtcccttaccgctggccccctgtgctgctgggtgaggcc
ctggtgaacctcctgatcggcctgggctacatccctgccctggccttctacttcatcaag
ctgcaggagacctacgacaaccccatctgtacggagagggaagcgctctacaagagcaaa
gggcatcagggctttgcgtgtgcactcaatggagcagacatcgctggaggcctcttcggr
gtgcttggagtcattgttttcatcttcggaatggtcttggccatccgtgctttcagggca
gtgagggagatgaagagaagagcgatggaagatggtaacttataa

DBGET integrated database retrieval system