KEGG   Salvelinus alpinus (Arctic char): 111974857Help
Entry
111974857         CDS       T05762                                 

Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00590  Arachidonic acid metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111974857
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     111974857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 111974857
NCBI-ProteinID: XP_023858684
LinkDB All DBs
AA seq 598 aa AA seqDB search
MRECIVCVWAFILLLRLPTCPGEEIKDASANVVNPCCYYPCQNWAVCVRFGTDRYECDCT
RTGFYGQNCTIPEFWTRVYLKLKPSPDVVHYILTHFHWLWSLINRTFLRDWLMRVVLTVR
ANLIPSPPTFNSKYGYLSWESYSNVSYYTRILPPVPEGCPTPMGAKGKSVLPDPKLVVET
FLLRRKFRPDPQGTNLMFAFFAQHFTHQFFKTQNSMGLGFTRALGHGVDAGHVYGDSLVR
QLNLRLLKDGKMKYQVIKGEVYPPTVAEAPVNMSYPRGVPEGQRMAIGQEVFGLLPGLTM
YATLWLREHNRVCDILKAEHPTWGDEQLFQTTRLIVIGETIRIVIEDYVQHLSGYLLDLK
FDPVLLFKSTFQYRNRIAVEFNQLYHWHPLMPDSFHIDGDVVPYSQFIFNTSIVTHYGVE
KLVDAFSRQCAGQIGGGKNIHPVVTKVAEGVIEESRALRLQPFNEYRKRFNLRPYTSFSD
FTGEEEIARELEELYGDIDALEFYPALMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPIC
SPEYWKPSTFGGQTGFDIVNSASLERLVCLNSKWCPYVAFSVPPAGQEPPPRKPSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtgcatcgtgtgcgtatgggcgtttatcctgctgctaaggttaccaacatgt
ccaggggaagagatcaaagacgcctctgcgaatgttgtgaatccctgttgctattacccc
tgtcagaactgggctgtgtgtgtcaggtttggcactgaccgctatgaatgtgactgcact
cgcaccggcttctatggacagaattgcactatccctgagttctggacaagggtctacctg
aagctgaagccgagccctgatgtggtccactacatccttacacacttccactggctgtgg
agcctcattaacaggaccttcctacgggactggctcatgagggtagtcctcacagtcaga
gcaaaccttattcccagtcctcctaccttcaactcaaagtatggatacctcagctgggaa
tcctactccaatgtctcctattacacccgtatcctaccccctgtgcctgaaggctgcccc
acccctatgggtgccaaaggaaagtctgtcctcccagacccaaagctggttgtggagacg
tttctgctgaggaggaagttcaggccggatccacagggaaccaacctgatgtttgctttc
ttcgctcagcacttcacccatcagttcttcaagactcaaaacagcatgggcctgggcttc
accagggcgctggggcatggggtggatgccggccatgtctacggcgatagtctggtgcgt
caactgaacctccggcttcttaaagacggaaagatgaaataccaggtaattaaaggtgag
gtgtaccctccaacggtagccgaggcaccggtgaatatgagctaccctcgaggggttccc
gaggggcagcgcatggccattgggcaggaggtgtttgggctgctgccaggcctcaccatg
tacgccaccctgtggctgagagaacacaaccgcgtctgtgacatcctgaaggccgagcac
cccacctggggggatgagcagctcttccagaccaccaggctcatcgtcataggtgagact
atccggatagtgatcgaggactacgtgcagcacctgagcggctacctgttggatctgaag
ttcgatccggttctgctcttcaagtccacgttccagtacaggaaccgcatcgctgtggag
ttcaaccaactgtaccactggcaccccctgatgccagacagcttccacatagacggagac
gtggtgccctactcccagttcatcttcaacacctccatcgtcacacactacggggtggag
aaactggtggacgctttctcacgccagtgtgctggacagattggaggtgggaagaacatc
cacccagtggtgaccaaggtggccgagggtgttattgaagagtccagggctctgcgtctc
caacccttcaacgagtacaggaagaggttcaacctgaggccctacacatctttctctgat
ttcactggtgaggaggagatagccagggagctggaggagctctatggtgacatcgatgcg
ctggagttctaccccgccctcatgctggagaagacacgccccaacgccatatttggcgag
agcatggtggagatgggggctccgttctccctgaaaggccttctgggtaacccgatctgt
tcccctgagtactggaagcccagcacgttcggaggccagacaggctttgatatagtcaac
tcagcctcgctggagagactggtgtgtctgaacagtaagtggtgtccgtacgtagccttc
agtgtgcctccagccgggcaggagccgccgccaaggaaaccgtccactgaactgtaa

DBGET integrated database retrieval system