KEGG   Salvelinus alpinus (Arctic char): 111975092Help
Entry
111975092         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp03030  DNA replication
salp03410  Base excision repair
salp03420  Nucleotide excision repair
salp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111975092
   03410 Base excision repair
    111975092
   03420 Nucleotide excision repair
    111975092
   03430 Mismatch repair
    111975092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:salp03032]
    111975092
   03400 DNA repair and recombination proteins [BR:salp03400]
    111975092
Enzymes [BR:salp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111975092
    6.5.1.6  DNA ligase (ATP or NAD+)
     111975092
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111975092
DNA replication proteins [BR:salp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111975092
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111975092
DNA repair and recombination proteins [BR:salp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111975092
   NER (nucleotide excision repair)
    Other NER factors
     111975092
   MMR (mismatch excision repair)
    Other MMR factors
     111975092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 111975092
NCBI-ProteinID: XP_023859031
LinkDB All DBs
AA seq 1169 aa AA seqDB search
MQRSISSFFQPKTGKEKESKESDGPVKDKSVKDKSVKDKSVKDKSVKDKSVKDKSVKDKP
VKDKPVKDKPVKDKPVKDKPVKDKPVKDKPVKDKPEPVKRPLKVQNGVHEEPDSPVKKFT
KRSRQILDSDDDDDDEAPAGIEQEQEDKAVQPKDEVFKAVTTPLSPASPVTTSASPVTXS
ASPVTSSASPVTSSASPVTXSAXPLTXSATPVTPAASPTPGTPDTPTSISPSGIPKRRTA
RKQFPKRKLDSRSGSEKEEEEQGQQNKRAKVEETQDSTENEEEAMDVGGENSVDKPGVAQ
NNPEEKETDEEKTKDGEKEKALDVKETATEKAEEEKGKSEKAKERSPKERSPKGQKAKER
SPKGQKVKERSPKGQKAVKDEKEKRSPKNERKEEKDMKEEKVSESPQAKKVPTISSFFAP
RKAAVKMERPEKSEGDGKEKSEGDGKEKSEGDGKEKSEGDGKEKSEGDGKEKSEGDGKEK
SEGDGKEKSGEYIKEEATVSRTPEDVKDKKGEKTAQAQYDPSRPNYHPVDHACWSRGHRV
PYLAVARTFEKIEEDSGRLRNIETLSNLLRSVIVLSPEDLLCCVYLCLNQLGPAYMGLEL
GVGDTVLMKAVAQATGRQLDKIKAEAAEKGDLGLVAESSRNNQRIMFQPANLIAGGVFNK
LKDIGNMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSALSQAV
CLTPPGQDFPPAVVDAGKGMSAEKQKAWIEEKSLVLKQTYCEMPNYDVIIPVXLKEGIDE
LPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILENGEVRIF
SRNQEDNTTKYPDIISRIPTVKNESVISCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVA
AADIKVQVCVYAFDLLYLNGESLVKKPLSCRRALLKESFQEKEGEFVFARAIDSDNTDVI
AEFLEQSVRDSCEGLMVKTLEKDATYRIAKRSHNWLKLKKDYLDGVGDTMDLCVIGAYLG
KGKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHYKFLKEHILPKPRPYYRVD
QSTEPDLWLDAVQVWEVKCADLSLSPIYKAGMGLCDPEKGISLRFPRFLRIRDDKKPEEA
TSGGQIADLYRKQQVVQNQGDKADLEDYY
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatatcatctttctttcagcccaaaacgggcaaagagaaggagagcaaa
gaaagtgatggaccggtgaaagacaagtcggtgaaagacaagtcggtgaaagacaagtcg
gtgaaagacaagtcggtgaaagacaagtcggtgaaagacaagtcggtgaaagacaagccg
gtgaaagacaagccggtgaaagacaagccggtgaaagacaagccggtgaaagacaagccg
gtgaaagacaagccggtgaaagacaagccggtgaaagacaagccagaaccagtcaaaagg
cctctcaaagttcagaatggggtccatgaagagcctgattcgccagtaaagaagttcact
aaacgcagtcgtcagatcttggacagtgatgatgatgatgatgatgaggctccagccgga
atagaacaggagcaagaggacaaggctgtgcaacccaaggatgaagtattcaaggctgtt
accacccccctgtcccccgcctctccagtgaccacatccgcctctccagtgaccwcatcc
gcctctccagtgacctcatccgcctctccagtgacctcatccgcctctccagtgaccwca
tccgccwctccaytgaccwcatccgccactccagtgaccccagctgcctcccccacccct
ggaacccctgacacccccacttccatctcaccttccggaatacccaaacgccgcaccgca
aggaagcagttccctaagagaaagctggacagccggagtggcagtgaaaaggaggaggaa
gaacaaggacagcagaataaaagagcaaaggttgaggagacacaggacagcaccgagaat
gaagaggaagcgatggacgtgggaggagagaacagtgtggataagcctggggtggcgcag
aacaacccggaggagaaagagacggatgaagagaagaccaaagatggagagaaggagaaa
gcacttgatgtgaaagagaccgcgactgagaaggctgaggaggaaaaaggaaaaagtgaa
aaggctaaagagagaagccctaaagaaagaagtcctaagggtcaaaaggctaaagagaga
agtcctaagggtcaaaaggttaaagagagaagtcctaagggtcaaaaggcggtaaaggat
gagaaagaaaaaagaagtcctaaaaatgaaaggaaggaggagaaagacatgaaagaagag
aaagtgtcagaaagcccccaagccaagaaagtccccaccatcagcagtttctttgctccc
aggaaggctgctgtaaagatggagagaccagagaagagtgagggagacggaaaggagaag
agcgagggagacggaaaggagaagagcgagggagacggaaaggagaagagcgagggagac
ggaaaggagaagagcgagggagacggaaaggagaagagcgagggagacggaaaggagaag
agcgagggagacggaaaggagaagagcggggagtatataaaggaagaggcgacggtgtcc
cgtaccccggaggacgttaaagacaagaaaggagagaagactgcccaggcccagtatgac
ccgtccagacccaactatcaccctgtagaccacgcctgctggagccggggacayagggtc
ccgtatttggctgttgcacgcacctttgaaaagattgaggaagattctggcagattgagg
aacattgaaacattatctaatctcctacgctctgttatcgtcctctctccagaggacctg
ctgtgctgcgtctacctgtgtctcaatcagctgggtcctgcttacatggggctggagctg
ggagtgggagacactgttctgatgaaggctgtcgcccaagctactgggcgacagttggac
aaaatcaaggcggaggctgcagagaagggggacttggggttggtggctgagagttcccgt
aacaaccagagaattatgttccagccagccaatcttattgcggggggtgtgttcaacaaa
ctgaaagacatcgggaacatgagtgggaattctgccatgaataagaagatcgacatcatc
aaaggtctctttgtagcctgtcgtttctctgaagccagatacattgtcaggtcgctggca
gggaagctgaggattggcttggctgaacagagtgtactctctgccctgagtcaggccgtg
tgtctgactcctccaggacaagacttccctccggcggtggttgacgcggggaaaggaatg
agtgcagaaaaacagaaagcttggatagaagagaagagccttgtcctcaaacagacttac
tgtgagatgcccaactatgatgtcatcatcccagtcatrctgaaggaggggattgatgaa
ctccccaaccactgcaaactcactccaggtgtaccgttgaggcccatgctggctcacccc
accaaaggtgtaggagaggtgatgaagagatttgatgaagctgccttcacctgcgagtac
aagtatgatggagaacgagcacagatccatatcttggagaatggggaagtgcgtattttc
agtcgcaaccaggaggataataccaccaaatatcctgacatcatctcccgcattcctacg
gtaaagaatgagtctgtgatttcctgtgtgttggactctgaggcagtagcttgggacaga
gagaagaagcagatccaaccattccaggttctcaccacacggaagagaaaggatgtggct
gcagctgatatcaaggtccaggtgtgtgtgtacgccttcgacctgctgtatctcaatgga
gagtctctagtgaagaagcccttgtcatgtcgcagggctctgttgaaggagagcttccag
gagaaggagggagagtttgtgttcgcccgtgccatcgactcagacaacacagacgtcatc
gctgagttcctggagcaatcggttcgagactcctgcgagggactcatggtgaagactctg
gagaaagatgccacgtatagaatcgccaagcgctctcacaactggctcaagctgaagaag
gattatctggatggcgtgggggacacgatggatctgtgtgtgatcggagcgtatctgggg
aagggcaagagaacagggacctacggaggctttctgctcgcctgctacgatgaggacaat
gaagagttccagtcggtctgcaagattgggacagggttcaaggatgaagatttggagcaa
cattataaattcttaaaggagcatattttgccaaagccacgcccctattaccgtgtggac
caatcaactgagcccgacttgtggctcgatgccgtgcaagtatgggaagtgaagtgtgct
gacctatcgctgtcgccgatctacaaggctggaatgggattgtgtgacccagagaagggc
atctctcttcggttcccacgcttcctgaggatcagagatgataagaagccagaggaggcc
acttcaggaggacagattgctgatttatacaggaagcagcaggttgttcagaatcagggc
gacaaagctgaccttgaggactactactga

DBGET integrated database retrieval system