KEGG   Salvelinus alpinus (Arctic char): 111976174
Entry
111976174         CDS       T05762                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04020  Calcium signaling pathway
salp04144  Endocytosis
salp04510  Focal adhesion
salp04540  Gap junction
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111976174
   04020 Calcium signaling pathway
    111976174
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111976174
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111976174
   04540 Gap junction
    111976174
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111976174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111976174
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:salp04090]
    111976174
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111976174
Protein kinases [BR:salp01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111976174
CD molecules [BR:salp04090]
 Proteins
  111976174
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Receptor_2B4 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 111976174
NCBI-ProteinID: XP_023860711
LinkDB
AA seq 1467 aa
MDETKTCLIIGVFLFGLLSVTRGLATPTIVSTEDEFVLEPLSVFNISCTGKRNVAWVEPL
PDDTFVLPGYYTSTLFIYNASVTHTGYYSCKYQYKEGDEEVDGVANDAFIYVFVPDPEIP
FVPEEPDRMLVPIYPNRTIIPCRVSDPQSQVVLKSAPSGVEVDAVYKNKIGFIGNLDAGL
YICETTVNGMTMTSDTYTVEANKQMENVHMEVKASEEAVRLGEPFNITCVAPPGLPYQQQ
WLHPRKQAADAVQMKQTLPDRVVYTLSIPAATSQDSGVYECSITNNVSGEIRANRVAVTV
FEENTFVMLDHSGIGVVEFVSMMEETEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTS
HLEGNQHQSTLTLRQPLEEDSGNYTIVVLSIPHTAQFSFTLKVKESGPVLFQPASAPVLF
PQREEWIVPLHTPFTLTCRGEAELAWDTPVYLSEQTEEDNSGLFITTVTVENATAGHTGF
YICFYKGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPYGNHVLNGHDEMEIQCRVSDPGAN
VTLVNADTQQAVPMAVYDSKRGAVGFFSAGTYVCKALVNGEEHLSEEYIVHGWAGGSELH
VELKAQKTALLVGDTITVICVARGSEILEDHWKYPGKLAARGLKSVRENKRDQEIQYTLT
VPQASAKDSGIYVCSITDIISNENQTKKLAITVYERPFVSLRPAFSSQESADLDEVRQFQ
ADIDSFPSAQVTWLKDGLPLNDVAAEITTSLRQVSETRYQSVLTLIRAKEEDSGNYTIRV
QNGNQTHSHNFSLQVKVPAVIVDLKDLHHGSATGQSVVCIAGGMPTPEVEWFICKNIKHC
ANDSSQWVPLPTNNTEITVEAHMDQDKQLESRVIFGHLENTLAVRCLARNEMAVVSREVK
LVSQGPHSELPVTAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYV
DPMQLPYDSRWEFSHDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARS
SEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYLHKNRENFLS
LHSEKTKKDLDIFGINPADESSRSYVILSFESGKGDYMEMKQADTMQYVPMLEMSDASKY
SDIQRSEYDHPPSQKGDNEMDSLLSEDGNEGLSTTDLLSFTYQVARGMEFLSSKNCVHRD
LAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTLSDV
WSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPADVYEIMIKCWNSEPE
KRPSFLSLSESVASLLPSGYKRCFERASHEFLKSDHPAVTRVQVESEDTYIGITYKSQDK
LKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYIKRIRHSSQTSEESAIETGSSFTLAK
REGETLEDISLLDEMCLDSELVEDSFL
NT seq 4404 nt   +upstreamnt  +downstreamnt
atggatgaaacgaagacatgtctcatcattggggttttcttgtttgggttgttatcagtt
acccgcgggctggccacaccgaccattgtatcaactgaagatgagtttgttctcgagccg
ctctcggtgttcaacatcagctgcaccggtaaaaggaacgttgcttgggtcgagccccta
ccggacgacacattcgttttgcctggatattacacctccacgctcttcatctacaacgct
tctgtgacacacaccggatattactcctgcaaataccaatacaaagagggcgatgaagag
gtggatggcgtagccaatgatgcgttcatatacgttttcgtcccagatcctgagattcca
tttgtgcctgaggagccagatcgcatgctagtcccaatctatcccaatagaaccatcatc
ccatgcagggtgtcagaccctcaatcccaggtggtcctaaagagtgctcccagtggagta
gaggtggacgcagtttataagaacaagatcggcttcattggcaacctggacgctggcttg
tacatctgtgagaccaccgtgaacggcatgacaatgacgagtgacacttacaccgtggag
gccaacaaacagatggagaacgtccatatggaggtgaaggccagcgaggaggcagtgaga
ctgggggaacccttcaacatcacctgtgtggcacctccaggactgccctaccagcagcag
tggctccaccccaggaaacaggctgcggatgcagtccagatgaaacagactctgcctgat
agagtggtctacaccctcagtatcccagcagccacctctcaggacagtggggtgtatgag
tgctccatcaccaacaacgtcagtggagagatcagagccaacagggtggctgtcactgtc
tttgaagagaacacctttgtgatgttggaccacagtgggattggagtggtggagtttgtc
agtatgatggaggagacagagttcaccatcagtattgaagccttccctgctcctaaagtc
acctggctgaaagacggtatcgctatcactgagaacagctacttcctcaccaagaccagc
catctggaggggaaccagcatcagagcactctgactcttcggcagccactagaggaggac
agtggtaactacaccatcgtggtcctcagcatccctcacactgcccagttctccttcacc
ctcaaagtgaaagaatcagggccagtactgttccagccagcctcagcgccagtgctgttc
ccccagagagaggagtggattgttcccctccacacccccttcaccctgacctgcagaggc
gaggcagagctggcctgggacacgcccgtgtacctatcagagcagaccgaggaggacaac
agcggcctgttcatcaccacggttaccgtagagaacgcgacagcagggcacactggcttc
tacatctgcttctacaaaggagggaactccactgaggagggagaggacagcagcatctac
atatatgtgccagatccagaggtgcccttcgtaccctcgctggtgccctatggcaaccac
gtcctgaatggtcacgatgagatggagatccagtgccgcgtgtcggaccccggtgccaat
gtgaccctggtcaacgctgatacccagcaggccgtgcccatggcggtctacgacagcaag
aggggtgccgtgggcttcttcagcgcaggaacctacgtctgtaaggccctcgtcaacgga
gaggagcacctcagtgaggagtacattgtccacggctgggcaggggggtcggagctgcat
gtggagctgaaggcccagaagacagccctcttggtgggagacaccatcactgtcatttgt
gtggcccgggggtctgagatactggaagaccactggaagtaccctggaaaactggcggcc
cggggcttgaagtcggtgcgtgagaataagagggaccaggagatccagtacacattgact
gtcccccaggcctcagccaaagacagcggcatctatgtctgctccatcactgacatcatc
agcaacgagaaccagaccaagaagctggccatcactgtctatgaaaggccattcgtgtcg
ctgcgcccggcgttcagttcacaggagtcagcagatttggatgaggtcagacagttccag
gctgacattgactcctttcccagcgctcaggtcacatggctcaaagatggcctccctctc
aacgacgtggcagctgagataaccaccagcctccggcaggtcagcgagaccaggtaccag
agtgttctgaccctgattcgggccaaagaggaggacagtgggaactacaccatcagagtg
cagaacgggaaccagacccacagccacaacttcagcctgcaggtcaaagtgcctgcagtc
attgtggacctgaaggacctccaccatggctcagccacaggccagtctgtagtgtgtatc
gctggaggcatgcccactcctgaagtggagtggttcatctgcaagaacataaaacactgt
gccaacgactcgtctcagtgggtgcccctgcctaccaacaacacagagatcactgtggaa
gcgcacatggaccaggacaaacagctggagagtcgagtgatctttgggcatctggagaac
accttggccgttcgctgcctggccaggaacgagatggccgttgtcagcagggaggtgaag
ctggtgtcacaaggcccccactctgagctgcctgtaactgctgctgttttggtgctgctg
gtcattgtcatcatctcactcattgtcctggtcattatctggaaacagaagcctcgctat
gagatccgttggagggtgatagagtcagtgagccctgatggccatgagtacatctacgtt
gaccccatgcaactgccctatgactccagatgggagttttctcacgatgggctcgtactg
ggtcgtgtcctgggctctggggcgtttgggaaggtggtggagggaactgcatatggactc
agccgctcccagcctgtcatgaaggtggctgtgaagatgctgaaacccacggcccgctcc
agtgagaaacaggccctcatgtcagagctgaagatcatgactcacctgggccctcacctc
aacatcgtcaacctgctgggggcctgcaccaagtcaggccccacctacatcatcactgag
tactgcttctatggagacctggtcaactacctgcacaagaacagagagaacttcctcagc
ttgcactcagagaagaccaagaaagacctggacatctttggcataaaccctgcagacgag
agcagcaggagctatgtgatcctgtcctttgaaagtggtaaaggggactacatggagatg
aagcaggcagacaccatgcagtacgtgcccatgctggagatgagtgatgcctccaagtac
tccgacatccagaggtctgaatatgaccacccaccatcacagaagggtgataatgagatg
gacagcctgctgtcagaagacggcaacgagggcctcagcaccacagacctgctcagcttt
acctaccaggtggccagaggcatggagttcctgtcctctaagaactgtgtgcatcgggac
ctggctgctaggaacgtcctgctctctcaggggaagatagtgaagatctgtgactttggc
ctagccagagacatcatgcatgacaacaactatgtctccaaaggcagtaccttcctgcca
gtgaagtggatggctcctgagagtatctttgacaacatgtacaccaccctcagtgatgtc
tggtcctacggcatcctcctctgggagattttctctctaggtggcaccccatacccaggg
atggtagtggactccagcttctacaacaagatcaagagtggctacaggatggccaaaccc
gagcacgcccccgctgatgtgtatgagataatgataaagtgttggaacagtgagcctgag
aagaggccttccttcctcagcctgagtgagagtgtggcttcactgctgccttccggctac
aagaggtgcttcgagagggcaagccatgagtttctgaagagcgaccatccagcagtgacc
agggtccaggtggagagtgaagacacctacattgggatcacctataagagtcaggacaag
ttgaaggacagggagagtggcttcgacgagcagcgcctcagctctgacagcggttacatt
atccccctccctgacctggaccctctgtctgatgatgagtacatcaagaggatccgccac
agctctcagacatctgaagagagtgccatagagacaggctccagcttcacactggccaag
agggaaggagagaccctggaggacatcagcctgttggatgagatgtgtctggactcagag
ctggtggaagacagtttcctgtga

DBGET integrated database retrieval system