KEGG   Salvelinus alpinus (Arctic char): 111976617Help
Entry
111976617         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: F-actin-monooxygenase mical1-like isoform X1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     111976617
Membrane trafficking [BR:salp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    111976617
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    111976617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM FAD_binding_3 Pyr_redox_2 Pyr_redox_3 NAD_binding_8 FAD_binding_2 HI0933_like DAO CH_2 Pyr_redox AlaDh_PNT_C Cdc6_C Thi4 NAD_binding_7 Lar_restr_allev
Motif
Other DBs
NCBI-GeneID: 111976617
NCBI-ProteinID: XP_023861353
LinkDB All DBs
AA seq 1299 aa AA seqDB search
MVNQDPTNPSHALFDQFVQTQTCKEVQRTFSELCHHLQLDPRDYQRFYTKLKERLNYWKA
KALWIKLDKRAQHQDYQQGKVCAKTKCLVLGAGPCGLRTAIELALLGAQVVVLEKRDSFS
RNNVLHLWPYTIYDLRGLAAKKFYGKFCTGALDHISIRQLQLILLKVSLLLGVDVNTGVE
FKGFVEPSEATGWMAKLYPDDHPAGKFQFDVFISAGGGRFVPDGFRWKELRGKLAIGITC
NFINHHSAAEAQVAEISGVARIYNQKFFQDLLTEKGIDLENIVYYKDATHYFVMTAKKKS
LLKMGVIKQDFSDANQLLGQANVDQDALLRYAHGAAHFSTGHRLPNMQFALNHAGQPDVA
MFDFTCMHRAENASLVRERKGKKLLMGLVGDCLVEPFWPLGTGIARGFLAAFDTAWMVRS
WGKGKPHLEVIAERESIYQLLSQTTPENISKNYSAFSIDPTTRYQHVNLNSIKTKQLQHL
YDVEDHIDLGQPTKKQKGRLSHLRQDSVGAFEELLKWCQQHTAGYDRVKVKDLTQSWRSG
LALCALINTFRPHLIDMSSLKESDSVHNNQLAFSLLEEELGIPPIISASDMATKEQIDKL
SMVLXLTQIHDAFNERTPTRAEPPSLLLTPSKTLSFQAVFFLNKLKHNSLQRRKERLAAE
TEEKDKRETEEKDKRMRMGDEEDPVAPLAAPEVTPDPELSPTSMNNEECYFCGQRVYVLE
RISTEGKFFHRSCFTCQQCGTTLRLGSYTFSQHTGKFYCDLHSEQLEIENREQSPSVKDN
IGDHEEEKGVNSITSEDPSPCPSEDDEYYLDSGPPKPMEPLHPPSQEDPSSKQPNPVEEP
PVSPKPPIDIFIKKGFEDCEVEEEGKEGGEDAPSDPLTPVPKPRQARSAIPNPQTSPPVP
KPRTVLLTPKRDTSPAHVGEKGSSRAAGEKGTPKAAPDSRPKPSLRKLQLTDEEKNHLVN
LSFSLDSDSETPGSSSCSSSSATAGGPCPPKPPGADGQEEEGYWSGGPGAGGHIREHRNR
RCFRRKEEPAEGQGQHARVRSKFSPWNLSSPRLGRDQRFSVLNSHPEVHHGHSVSEEDGA
DDDDEEEEDELDMFAPDGLDLYDDKFQTIPSDPVEAEKLELLKMRTLDRRAKTCEMQRFH
KAQSIQRRLEEIEVTFKELEDKGVVLEQVLRGEEGSGGSPEMIDQWIHLVHQKNALVSEE
SDLMVASRQLELEDKQSMLEMELRQYMELDDSEKTAEQQGEEDRVLQEMLEVVDMRNSLV
SFLDEKRLKEIESDKQQAISLLEAKRHSTASAGAQVHWA
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaccaagaccccaccaacccctcccatgccctctttgaccagtttgtccagacc
cagacctgtaaggaggtgcagcgtaccttctcagagctctgccaccacctacaattggac
ccccgggactaccagagattctacaccaagctcaaggagaggctcaactactggaaggcc
aaagctctctggatcaagctggacaagcgagcccaacaccaagattaccagcagggcaaa
gtctgtgccaaaaccaagtgcctggtgctgggtgcagggccgtgcgggctgaggacagcc
atagagctggctctgctgggggctcaggtggtggtactggagaagagggactctttttcc
cggaataacgtactgcacctctggccttacaccatctatgacctgcgtgggctggctgcc
aagaagttctacggcaaattctgcactggggctctggatcacatcagcatccgtcagctc
cagctgatactactgaaggtgtctctcctcctgggggtggatgttaacactggggtggaa
ttcaaaggctttgtggagccctcagaagccacaggctggatggccaagctgtatcctgac
gatcaccctgctgggaagttccagtttgatgtcttcatctctgcaggaggaggacgcttt
gtccctgatggcttcaggtggaaggagctgcgaggaaagctggccatcggcatcacatgt
aacttcatcaaccatcactcagcagccgaggcccaggtggcagagatcagtggtgtggcc
cgcatctacaaccagaagttcttccaggacctgctcacagagaaaggtattgatctggag
aacatagtctactataaagacgccacccactactttgtcatgactgccaagaagaagagc
ctgttaaagatgggggtcattaaacaggacttcagcgacgccaatcagctcctgggccag
gccaacgtggaccaggacgccttgttgcgttacgcccacggcgctgcccacttctccaca
ggccaccgcctgcccaacatgcagtttgccctgaaccacgctggccagcctgacgtggcc
atgtttgacttcacctgtatgcaccgtgctgagaacgcctcgctagtcagggagaggaaa
ggaaagaaactactcatgggcctggtcggagactgcctggtggagccattctggcctctg
ggaacaggtattgcccgtgggtttctggctgccttcgacacagcgtggatggtcaggagc
tggggcaagggaaaaccccacctggaggtcattgctgaacgggagagtatctaccagctc
ctgtcccagaccacgccagagaacatcagtaaaaactacagtgcctttagcatagacccg
actacacgctaccagcacgtcaacctcaactccatcaagaccaarcagttgcaacatctg
tatgatgttgaagaccatattgatttgggccaaccaaccaagaagcagaaaggcaggttg
tctcacctgcgacaagattcagttggagcttttgaggagctgttgaagtggtgccagcag
cacacggcagggtacgacagggtgaaggtgaaggatctgacccagtcctggaggtctggc
ctggccttgtgtgccctcatcaacaccttcagaccccatcttattgacatgtcctctctg
aaggagtctgattcggtccacaacaatcagctggccttcagcctcctggaggaagagctg
ggcatccctcccatcatatcagccagtgacatggccaccaaggaacagatagataagctc
tccatggtgctctarctcacacagatccacgatgccttcaacgaaaggacgcccactaga
gcagaacccccgagccttctcctgacaccgtccaagaccctgtcttttcaggctgtgttc
ttcctcaacaagctcaagcacaactctctgcaaagacgcaaggagagactggcagccgag
acagaagaaaaagataaaagggagacagaagaaaaagataaaaggatgaggatgggagat
gaggaagatcctgtagcccctctcgcagcccctgaggtgacccctgaccctgaactaagc
ccgacgtcaatgaacaacgaggagtgttacttctgcggccagcgggtctatgtgctggaa
aggatcagtactgagggcaagttcttccaccgtagctgcttcacctgccagcagtgtggc
accaccctcagacttggcagttatacctttagccagcacacggggaagttctactgtgat
ctgcactctgaacagctagagatagagaacagggaacaatccccatccgttaaggataac
atcggagatcacgaggaggagaaaggtgtgaattcgatcaccagtgaagacccctcacct
tgtccctctgaggacgatgagtactatctagactcgggtcctcctaaacccatggagcct
ctgcatcctccgagtcaggaagaccccagtagcaaacaacctaaccctgtagaggagccc
cctgtctcaccaaaaccacccatagacattttcataaagaaagggtttgaggactgtgag
gtggaggaagaggggaaggaggggggtgaggatgccccctcggatcctctgacccctgtc
ccaaaacctcgccaagctcgctcggccatcccaaaccctcagacctcccctcctgtaccc
aaaccacgcaccgtcctcctcaccccaaaaagggacacgtcaccagcccatgtaggggag
aaggggtcctccagggcagcaggagagaaagggacccccaaggcagcccctgactccagg
ccgaagccatccctgcggaagctgcagctgaccgacgaggagaagaaccacctagtcaac
ttgagcttcagcctggactctgactcggagacacccggttcttcctcctgctcctcttcc
tcagccacagcagggggtccctgcccacccaaacccccaggtgcagacggccaggaggag
gagggctactggagtgggggccctggcgcggggggacacatacgggagcacaggaaccgc
cgctgcttcaggaggaaagaggaaccagcggagggccagggtcagcacgccagggtccgc
tccaagttctccccctggaacttgtcctcccctcggctggggagggaccaacgcttcagc
gtcctcaacagccacccagaagtacaccatggccacagtgtatctgaggaagatggtgct
gatgatgatgatgaggaggaggaggatgagttggatatgtttgcaccagatggcttggat
ttatatgatgataagttccagaccatcccttcagaccctgtggaggctgagaaactggag
ctgttgaagatgaggacattggatcgacgggccaagacgtgtgagatgcagcgcttccac
aaagcacagtctattcagagacgcctggaggagattgaggtgacgtttaaggagctggag
gataaaggtgtggtgttggagcaggtactccgaggagaggaaggcagtggaggttcccct
gagatgatcgaccagtggatccatctggtccatcagaagaacgccttggtctctgaggag
tcagacctcatggtggcgtctcgacagctggagttggaggataaacagagcatgctggag
atggagctcagacaatacatggagctggatgactctgagaagacggcagagcagcaggga
gaagaggaccgtgtgctacaggagatgctggaggtggttgacatgaggaactctctggtg
tccttcctggacgagaagcgactcaaggagatcgagagtgacaagcagcaggccatctcg
ctgctagaggccaagagacactccacagcctcagcaggggcacaggtgcactgggcgtga

DBGET integrated database retrieval system