KEGG   Salvelinus alpinus (Arctic char): 111978075Help
Entry
111978075         CDS       T05762                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00562  Inositol phosphate metabolism
salp01100  Metabolic pathways
salp04068  FoxO signaling pathway
salp04070  Phosphatidylinositol signaling system
salp04115  p53 signaling pathway
salp04140  Autophagy - animal
salp04150  mTOR signaling pathway
salp04218  Cellular senescence
salp04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111978075
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111978075
   04070 Phosphatidylinositol signaling system
    111978075
   04150 mTOR signaling pathway
    111978075
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111978075
  09143 Cell growth and death
   04115 p53 signaling pathway
    111978075
   04218 Cellular senescence
    111978075
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111978075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:salp01009]
    111978075
Enzymes [BR:salp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111978075
    3.1.3.48  protein-tyrosine-phosphatase
     111978075
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     111978075
Protein phosphatases and associated proteins [BR:salp01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    111978075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 111978075
NCBI-ProteinID: XP_023863638
LinkDB All DBs
AA seq 448 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKSHYKIYNLCVERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRSKFQEPQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTIKNRSEPIPLGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPLEESMEKVENGSVVVVVNDIEGVQNQPPGGPPPHAQPPQSAKRRDSGKDSDGDY
LILALTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEDSLNSEVSTSTSVTPDVSDNEPD
HYRYSDTTDSDPENEPFDEEQHTQITKV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgataataaaagaaatggtcagccggaacaaaaggagataccaggaggatggg
ttcgacttggacttaacgtatatctatccaaacatcattgctatgggctttcctgcagaa
cgactcgaaggagtgtacagaaacaatatagatgacgttgtacggtttcttgactcaaaa
cataaaagccattataagatttacaatctttgtgtagaacgacactatgatgctgccaaa
tttaactgcagagttgcacagtacccctttgaagaccacaatccgcctcagctagagctt
atcaagccattctgtgaagatctggaccagtggctgagcgaggatgacaatcatgtggcg
gccatccactgcaaggcagggaagggccgcactggggtgatgatctgcgcctacctcctg
caccgcagcaagttccaagagccccaggaggccctcgacttctatggggaagtgcggaca
agggacaagaagggagtgacaatcccgagccaacggcgctatgtgtactactacagccac
ctgctgaagaacaagctggactacaagcccgtggctctgctcttccataaaatggtgttt
gagacgctgccaatgttcagcggaggcacctgcagggacagtaccattaaaaacaggagc
gagccgatccctctgggcttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacgtccaacccggctcacacgcggagggaagaaaag
cacatgctatttgagtttccccaaccgctgcccgtgtgtggagacatcaaagtggagttc
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttctgggttaacacc
ttcttcattcccgggccattggaggagagtatggagaaggtggagaatgggtcggtggtg
gtggtggtgaacgacatagaaggggtccagaaccagcccccgggcggcccccctccccat
gcccagcccccccagagcgccaagcgcagggacagcggcaaggacagtgacggggactac
ctcatcctcgcgctgaccaaaaatgacctggacaaggccaacaaagacaaagctaaccgc
tacttctcacctaatttcaaggtgaagttgtatttcacaaaaaccgtggaagattctttg
aattccgaggtgagcacttcgacatccgtcactccggacgttagcgacaatgagcctgac
cattatcgatattccgacaccactgactctgatccggaaaatgaaccttttgacgaggaa
cagcacacgcaaatcacaaaagtgtga

DBGET integrated database retrieval system