KEGG   Salvelinus alpinus (Arctic char): 111978277Help
Entry
111978277         CDS       T05762                                 

Definition
(RefSeq) angiotensin-converting enzyme-like isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:salp01002]
    111978277
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111978277
   04090 CD molecules [BR:salp04090]
    111978277
Enzymes [BR:salp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     111978277
Peptidases [BR:salp01002]
 Metallo Peptidases
  Family M2
   111978277
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111978277
CD molecules [BR:salp04090]
 Proteins
  111978277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32 Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 111978277
NCBI-ProteinID: XP_023864016
LinkDB All DBs
AA seq 1298 aa AA seqDB search
MERMLWGAVVVLLPLLGLCQFVLPPEWVPGTFPATEAGAKDFVTAYNTAAELVIYQNQEA
SWTYQTNITPHNAEKKVESDGMKQDFTEAWGKKAKDNFSPTVLATFNTTLQRRLKKINIL
GAANLPARERNEYNVILSKMSEIYSTAKVCPKTNECWSIEPELTEIMANSRSYKTLLYAW
EGWHNASGVPLKAEYPKFVELSNKAYKTDGFDDTGAYWRSWYESKTFENDLEAIYKQVQP
LYQNLHAFVRRKLYDHYGPKYINLKGPIPAHLLGNMWSQTWNNIYGMMIPFPGKPNVDVT
DEMVAKNWNATHMFRVAEEFFTSLGLIKMPQEFWDKSMLEKPEGREVVCHASAWDFYNRK
DFRIKQCTTVNMQQLFTVHHEMGHVEYYLQYKEQPISFRRGANPGFHEAIGDVMSLSVST
PKHLASIGLLSNATNDNESDINYLLKMALEKMAFLPFGYLIDQWRWSVFSGHTPPERYNA
DWWHLRTKYQGICPPTKRTEEHMDAGAKYHIPGNTPYIRYFVSFILQFQFHKKLCQAANQ
TGPLHTCDIYQSKEAGKLLEAVLKSGESKPWEQVLQEAVGTNKIDASSLMEYFGPIITWL
KEQNAAMNETLGWPDFNWVPPIPEGYPEDIDMITDEVQAKNFLKEYNSTAEVVWNAYTEA
SWAYNTDINEKNRQNMLQKNLDMSNHTLTYGKEARKYDTTDFQDAAVKRILNKLGDIERA
GLPNEELKEYNNLLANMETKYSVAEVCRANGTCHPLDPDLQKIMAESRDYNELLFAWQGW
RNASGRELRQDYKRYVQLANKAAALNGHSDNGAFWRSLYETHSFEEDLEHLWKELEPLYL
NVHAYVRRSLYRKYGGKHINLKGPIPAHLLGNMWAQTWSGIMDLAIPYPDATQVDATPAM
IAKGWNATRMFQESDNFFTSLGLLPMPPEFWVKSMLEKPNDGRNVVCHASAWDFYNRKDV
RIKQCTVITMDDLITVHHEMGHVQYFLQYKDQPTSFRDGANPGFHEAIGDVLALSVATPK
HLKEIGLLDVVEDNPESMINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRISQEEYNKEW
WNMRMKYQGLCPPVARTEQDFDPGAKFHIPANVPYVRYFVSFIIQFQFHQALCNAAGHVG
PLHQCDIYRSKEAGKLLGDVMKLGFSKPWPEAMAMITGEPTMSAKPLVQYFKPLTDWLEA
ENNKNGEVRGWPEYDWKPPSDGSETSPTAATPTPTPTPVLDNGKVNFLGMSLDGAAAAAG
QWVLLVLGLVLLVATILLGYKHKKSKRRDLSSSELELK
NT seq 3897 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaatgctttggggagcggtggtggtgctattgccactcttgggactctgtcaa
tttgtcctgccacccgagtgggtgccagggaccttccctgccacagaggccggggccaaa
gactttgtcactgcctacaataccgccgctgagctggtcatctaccaaaaccaagaggcc
agctggacataccagaccaacattacgccccacaatgccgagaaaaaggtggaatctgat
gggatgaagcaggacttcacagaagcctgggggaagaaggccaaagataacttctctcct
actgtgttggccaccttcaacactactctgcagaggcgtctcaagaagatcaacatcctg
ggagcggctaacctacctgcaagagaaagaaatgagtacaacgtcatactaagcaagatg
tctgaaatatactctaccgccaaagtgtgtccaaagactaatgaatgctggtctattgag
ccagagctgacagagatcatggccaactcacggagctacaagacactgctgtatgcttgg
gagggttggcacaatgcatcgggtgtgccactcaaggcagagtatccaaagtttgtggag
cttagcaacaaggcctataaaactgatggtttcgatgacacaggagcatactggcgttcg
tggtacgagtcaaaracttttgagaatgacctggaggctatttacaaacaggtgcagccg
ctctaccagaatcttcacgcctttgtgcgccgcaagctctacgaccattacggaccgaaa
tacatcaatcttaaaggacctatccctgctcacctgctaggaaacatgtggtcgcaaacc
tggaacaacatctatggcatgatgatccccttccccggcaaacccaatgtggacgtgact
gatgaaatggtggccaaaaactggaatgctactcacatgttccgggtggctgaggagttc
ttcacctccctcggcctcatcaaaatgccccaagagttctgggacaagtctatgttggag
aagccagaaggtcgcgaggtggtgtgtcatgcatctgcctgggacttctacaatagaaag
gacttcaggatcaaacagtgcacaacagtcaacatgcagcagcttttcacagtgcaccac
gagatgggccatgttgaatattacctgcagtacaaggaacaacctataagcttccgccgc
ggtgctaacccaggcttccacgaggccattggtgatgtcatgtccctctctgtgtccaca
cctaagcatctggccagcatcggcctactgtctaacgcgaccaaygacaacgagagtgac
atcaactacctgctgaagatggctctggagaagatggccttccttccctttggttatctc
attgaccagtggagatggagtgtgtttagtgggcacacccccccagagcgatacaacgca
gactggtggcacctcaggacaaaataccagggtatatgtcctcccaccaaacgcacagag
gagcacatggacgctggagcgaaatatcacattccaggaaacaccccatacatcaggtac
tttgtgagcttcattctgcagttccagttccacaagaagctgtgtcaggcagccaatcag
acaggacccctgcacacatgtgacatctaccagtccaaggaggcgggaaaacttttagag
gcggtccttaaatctggagaatccaagccctgggaacaggtgctccaggaagccgtcggg
acaaacaagattgacgccagctccctgatggaatactttggtcccatcatcacatggttg
aaggaacagaatgcagcaatgaatgagaccttgggctggcctgactttaactgggttcca
cccataccagagggctaccccgaggatattgacatgattacagatgaggtgcaggcgaag
aatttcctgaaggagtacaacagcactgcggaagtggtctggaatgcctacactgaggca
tcgtgggcctacaacactgatatcaatgagaagaacaggcagaacatgctgcagaagaat
ttggacatgtctaaccacacacttacctacggaaaggaggcccgcaagtatgacaccaca
gacttccaggatgcggccgtgaagcgtatcttgaataaactcggtgacattgaaagggcc
ggacttcccaacgaggaactgaaagagtacaacaatttgctggccaacatggagaccaag
tacagtgtggctgaggtgtgcagagccaatgggacctgccatccactggacccagacctc
cagaagatcatggctgagtccagagactacaatgagctgttgttcgcctggcagggctgg
agaaatgcctctggcagagaactgcgacaggactacaagagatatgtgcaactggccaac
aaagctgccgctcttaacggacattctgacaatggggcgttctggcgctccctgtacgag
acccactcctttgaagaggatctggagcatctgtggaaggagctggaacctctctatctc
aatgtgcacgcctacgtgcgcaggtctctctacaggaagtatggaggcaaacacatcaac
ctgaagggacccatccctgcccatcttctaggcaacatgtgggcgcagacctggtctggc
atcatggacttggccattccgtaccccgatgccactcaagtagacgcgacaccagccatg
atagccaagggctggaatgccaccaggatgttccaagagtcagacaacttcttcacttct
ctggggctattgcccatgcctccagagttctgggtcaagtccatgctagagaaacccaat
gatggacgcaatgtggtatgccatgcctccgcctgggacttctacaaccgcaaagacgtc
aggatcaaacagtgcaccgtgataaccatggatgacctcatcaccgtgcaccatgagatg
ggtcatgtgcagtacttcctgcagtacaaggaccaacctacttccttccgcgacggcgcc
aacccaggcttccacgaggccattggggatgtgctggccctgtccgtcgccactcccaag
catctaaaggagattggtttactggatgtggtggaggacaacccagagagtatgatcaat
tacctcatgagcatcgccctggacaaaattgccttcctgcccttcggctacttgatggac
cagtggaggtggaaagtgtttgatggacgcatctctcaggaggagtacaacaaggaatgg
tggaacatgagaatgaagtaccagggcttgtgtccacctgtggcccgcactgagcaggac
tttgacccaggtgcaaagttccacatccctgctaatgtgccctatgtcaggtacttcgtg
agcttcatcatccagttccagtttcatcaggctctgtgtaacgccgccgggcatgtaggc
cctctccaccaatgtgatatctaccgctccaaagaggcagggaagcttctaggtgacgtg
atgaagctgggttttagtaagccctggcctgaagcgatggctatgatcactggagagcct
accatgtccgccaagccactggtacagtacttcaaacctctcactgattggctggaggca
gagaacaacaagaatggygaggtcagaggctggcctgaatatgactggaaaccaccaagt
gacggctcagaaacatcccccacagccgcaaccccaaccccaaccccaaccccagttcta
gataatggtaaagtgaactttctgggcatgagtctggatggtgcagcggctgcagcaggc
cagtgggtcctactggtcctgggcctggtgctcctagtggccaccatcctcctgggctac
aagcacaagaaatcaaaacgaagagatctgtcctcatctgagctggagctgaagtaa

DBGET integrated database retrieval system