KEGG   Salvelinus alpinus (Arctic char): 111979783Help
Entry
111979783         CDS       T05762                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00062  Fatty acid elongation
salp01040  Biosynthesis of unsaturated fatty acids
salp01100  Metabolic pathways
salp01212  Fatty acid metabolism
Module
salp_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    111979783
   01040 Biosynthesis of unsaturated fatty acids
    111979783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:salp01004]
    111979783
Enzymes [BR:salp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     111979783
Lipid biosynthesis proteins [BR:salp01004]
 Elongase
  PUFA
   111979783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO Nucleos_tra2_C
Motif
Other DBs
NCBI-GeneID: 111979783
NCBI-ProteinID: XP_023866256
LinkDB All DBs
AA seq 326 aa AA seqDB search
MLLELGSNIMSLYEYVLQRTDHRLLPYPLMRTPFQMTSILLGYVFFSLYAGPRLMVHRKP
YHLKTAMIVYNFSMVFLNAFLVYEFLMSGWGTTFTWRCDLCDYSSSPQALRMVRVAWWFY
FSKFIELLDTLFFVLRKKHSQITFLHVFHHSFMPFTWWWGMTIAPAGGMSSFHAMVNACV
HVIMYTYYGLSAAGPRFQKYLWWKKYMTAIQLIQFVLISLHISQYYFMEKCDFQVPMFIH
LIWMYGTFFFVLFSNFWIQAYIKGKRLPTATKEAKLKQNGVTNGHTNGITIGNISGVPNG
KQVENGNGTTAHRVNGHNQLGKVKEV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagaactgggatccaatattatgtcgttgtatgagtatgtattgcagagaacg
gaccaccggttgttgccctacccgttgatgcggacccccttccagatgaccagcattctg
ttgggctatgtattcttctcgctgtacgcagggcctcgcctgatggtacaccgcaagccc
tatcacctcaaaacggccatgatcgtctataacttcagcatggtgttcctgaacgccttc
cttgtctatgagttcctgatgtcaggatggggcaccacctttacctggagatgtgacctt
tgtgactactccagtagcccacaggctctaaggatggttcgagtggcttggtggttttac
ttctctaaattcatcgagcttctggacacattattctttgttctgcgtaagaaacacagc
cagattacatttcttcatgtcttccatcactccttcatgcccttcacgtggtggtggggc
atgaccatcgctcctgcagggggaatgagctcgttccatgccatggtcaacgcatgtgtc
cacgtcatcatgtacacctactacggcctgtctgctgcaggacctcgcttccagaaatac
ctctggtggaagaagtacatgaccgcaatccagctgatccagtttgtgctgatctcactt
cacatctctcaatactacttcatggagaagtgtgactttcaggtgcccatgtttattcac
ctcatctggatgtacggaaccttcttcttcgtactcttctctaacttctggattcaggcc
tacataaagggtaaacggctgccaacagcaaccaaggaggcgaagctcaagcagaatggc
gttactaatggtcataccaacggcattaccattggcaacatttccggggtgcccaacggc
aaacaagtggagaatggcaatgggacaacagcgcaccgtgtcaacggccataaccaacta
ggcaaagtgaaggaagtctag

DBGET integrated database retrieval system