KEGG   Salvelinus alpinus (Arctic char): 111980072
Entry
111980072         CDS       T05762                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111980072
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111980072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:salp04030]
    111980072
G protein-coupled receptors [BR:salp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111980072
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx PRA1 DUF3169
Other DBs
NCBI-GeneID: 111980072
NCBI-ProteinID: XP_023866511
LinkDB
AA seq 208 aa
MHVVDLHSKMTNRRVVLLIVCIWAGAIIMGLVPSIGWNCECHQLSNCSIITPLYSRRYMI
FWASLNLLTFSVMVAVYARIYVYVRRQGKRMSQHTSHHLRHNETVVNLMKTISIVLGVFV
ICWTPGLMTLLVDGIMGKDSHAVTYEKYCLILAECNSLVNPIIYSFLDEEMRRNFKCILC
CLCRRSSDHQGEQSPVEFNTLQPECVLT
NT seq 627 nt   +upstreamnt  +downstreamnt
atgcatgttgttgatctgcacagcaagatgaccaaccggcgtgtggtgctgctgatcgtg
tgtatctgggcaggggctatcatcatggggctggtcccctccatagggtggaactgtgag
tgccaccagcttagcaactgctcaatcatcaccccgctctacagccgcaggtatatgatc
ttctgggcgtctctcaacctgctcaccttttctgtcatggtggctgtgtacgcacgcatc
tatgtctacgtgcgacgtcagggtaaacggatgtctcagcatacctcccaccatctgagg
cacaatgagactgtcgtcaatctcatgaagactatctctattgtactgggagtgtttgtc
atatgttggacaccgggcctgatgactctgttggtagatgggatcatgggtaaagacagc
catgccgtgacctatgagaagtactgtctgatcctggctgagtgtaactccctggttaac
cctattatctactccttcctggatgaggaaatgagaaggaactttaagtgtatcctgtgc
tgcctgtgtaggaggagctctgaccaccagggggagcagtcacctgtggagttcaacaca
ctgcaaccagagtgtgttttaacctag

DBGET integrated database retrieval system