KEGG   Salvelinus alpinus (Arctic char): 111980315
Entry
111980315         CDS       T05762                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111980315
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111980315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111980315
   00536 Glycosaminoglycan binding proteins [BR:salp00536]
    111980315
Cytokines and growth factors [BR:salp04052]
 Growth factors
  Growth factors (RTK binding)
   111980315
Glycosaminoglycan binding proteins [BR:salp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111980315
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111980315
NCBI-ProteinID: XP_023866807
LinkDB
AA seq 119 aa
MNGGHLQILPDGTVAGGRDENKYDILNVKAVSAGVVAIKDHESGRYLAIDKDCNLHGSIK
TLKDECYFPEKTEENYYNTNRSQKYQDKDWFLGLQRNGQPKAGPRTHIGHKTIYSASTC
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaacggaggacatcttcagatcctacctgatggaactgtagcgggtggcagagatgaa
aacaaatatgacattctaaatgttaaagcagtgagtgctggtgtggtggccatcaaggac
catgagtcgggccgctacctggccatagacaaagattgtaatctccatggatcaataaaa
actttgaaggatgagtgttacttcccggagaagacggaggagaactattacaacacgaac
aggtctcaaaagtaccaggacaaagactggttcctagggctccagaggaacgggcagcct
aaagctggcccaaggacacacataggccacaaaaccatctattctgcctcgacctgttga

DBGET integrated database retrieval system