KEGG   Salvelinus alpinus (Arctic char): 111980383
Entry
111980383         CDS       T05762                                 

Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111980383
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111980383
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:salp03310]
    111980383
Transcription factors [BR:salp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111980383
Nuclear receptors [BR:salp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111980383
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111980383
NCBI-ProteinID: XP_023866876
LinkDB
AA seq 756 aa
MDNQDKSLDGGEEGSFSVNAGSSKSTTLISVMHLPGSTPQPPARDSSNGLNVTKIQGELS
TAGTASIGLSIEEAEVKLMGKALRMQNAQKQQQNHQQQQLFENFALLEESISDLNRSNTP
GSSVLGCSNYLFPLKTEDFSPMDKDRLDMGTVSFGQSLKDLDVNERLLGDNTLDILRDLD
LPGSLSDLNEFYLADEAAFLSSLSVDDALLGDGNMETKPIVSSSGGNCKNVNGADQHRQQ
LGPGISMPVIKTEKDADTSFIQLYTPGVIKQENERQSYCQISSLDIPGTHSSVXSMSGPS
YHYGGNTSTAVRVQQDQKPVFGLYPPLPSVSEGWNRGQEFGDGSGMSTPSSSSFPVSFSS
PTARPEVSSSTSSAPAKHSGPTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRAR
QNTDGQHNYLCAGRNDCIIDRIRRKNCPACRFRKCLQAGMNLEARKNKKLIRFKGQQATT
EPNAPDERACTLIPKSMPQLVPTMLSLLKAIEPEAIYSGYDSTIPDTSTRLMTTLNRLGG
QQVVSAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGGMLCFAPDLV
INDERMKLPYMTDQCEQMLKISTEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDE
IRMTYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMQEMVGGLLQICFYTFVNKSLSVE
FPEMLAEIISNQIPKFKDGSVKPLLFHHALNHDTMP
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggataaccaggacaagagcttagatggaggtgaagagggaagcttctcggttaacgca
ggcagttccaagtccaccacattaatttccgtgatgcatttgcctggctccacaccccag
cctccagccagagactcctctaacggactgaatgtcactaagattcagggtgagctctcc
acagcagggacagcctccattggactctctatagaggaggctgaagtgaagttaatgggc
aaggccctgagaatgcagaacgcacagaaacagcagcagaatcatcaacagcagcagctg
tttgagaactttgctctgttggaggagagcatttcagatttgaatagatccaacacccca
gggagctctgtacttggatgttctaattaccttttccctctgaaaactgaggacttttca
ccaatggataaggacaggcttgacatggggacagtcagctttggacagtcactgaaggac
ttggatgtcaacgagaggctccttggtgacaatacgctggacattctgcgggatttggac
ttgcctggctctctgtctgacctgaatgagttttacctggctgacgaggccgctttcctt
tcctccctgtcagtggatgatgccctgctcggtgacggcaacatggaaaccaagcccata
gtcagtagcagtgggggaaactgtaaaaatgtgaatggtgcggaccagcatcggcagcaa
ctgggcccagggatctccatgcctgtcatcaagacagagaaggacgctgacacctccttc
atccagctttacaccccaggtgtaatcaagcaggagaacgagcgccagagctactgtcag
atatccagcctggacatacctggtacccacagctcggtgygrtccatgagtgggccgagt
taccactacggcggaaacacatcgacggcagtgcgcgtacaacaggatcagaagcctgtc
tttggcctgtatccgccactgccctcagtcagtgarggctggaacagaggccaggaattt
ggggatggatcagggatgtcaactccatccagctcatcttttcctgtcagcttcagcagt
ccaacggccagacccgaggtcagcagctccacatcttcagcccctgccaagcacagcggt
ccaacccataagatctgcctggtgtgttctgacgaggcctctggctgccactatggagtc
ctcacctgcggaagctgcaaggtcttcttcaagagggccgttgaaggatggagagcacga
caaaacacagatggacaacacaactatctgtgtgccgggaggaatgactgcatcatagac
aggatccgcaggaagaactgtccggcgtgccgcttccgcaagtgtctccaagcagggatg
aacctggaagcaaggaaaaacaagaagctgatccgatttaaaggtcagcaggccacgaca
gagccgaacgcacctgatgaaagggcatgcaccctgatcccaaagtccatgccccagctg
gtgcccaccatgctgtccctgcttaaagccatcgagccagaggccatttactctggctac
gacagcaccatccccgacacctccacccgccttatgaccaccctcaacaggttgggcgga
cagcaggtcgtttcagccgtcaagtgggccaagtccctaccagggttccggaaccttcac
ctggatgatcagatgactctgctgcagtgctcctggctgttcctcatgtcattcggcctg
ggctggcgctcctaccagcagtgtaatgggggcatgctctgcttcgcccctgacctggtt
attaatgatgagaggatgaagctgccctatatgaccgaccagtgtgagcagatgctgaag
atctccactgagtttgtgaggttgcaggtgtcctacgacgagtacctgtgtatgaaagtc
ctgctgctgctcagcacagtaccaaaggatggattgaagagccaggctgtgtttgatgag
atccgcatgacctacatcaaggagctggggaaggccatcgtcaagcgggaagagaactcc
agccagaactggcagaggttctaccaactcactaagctactggactccatgcaggagatg
gtggggggcctcctgcagatctgcttctacacttttgtgaataaatcccttagtgtggag
ttccctgaaatgctggccgagatcatcagcaaccagataccaaaattcaaagatgggagt
gtcaagccgcttctgtttcatcatgccttaaaccatgacacaatgccttaa

DBGET integrated database retrieval system