KEGG   Salvelinus alpinus (Arctic char): 111980641
Entry
111980641         CDS       T05762                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2 isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111980641
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111980641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:salp04030]
    111980641
G protein-coupled receptors [BR:salp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111980641
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 111980641
NCBI-ProteinID: XP_023867254
LinkDB
AA seq 363 aa
MESGGRGNTCDYSHNVTFFYDYVGKEISRDWRVRDCVVVVLGLTICLIMILSNIMVMAAI
FINRRFHFPIYFLLANMAAADLFAGMAYTNLVLNTGPWTIRLSKQQWFIRNALVDMSLTA
SVANLLAVAVERHQTIITMQLHSKMTNRRVVLLIVCIWAVSIIMGLIPSMGWNCECQLSD
CSIIAPLYSRRYMIFWASLNLLTFSVMVAMYARIYVYVRRKGKRMSQHSSHHLRHNETVF
NLMKTISIVLGVFVICWTPGLMTLLLDGIMGKDSHALTYEKYCLILAECNSLVNPIIYSF
RDEEMRRTFKCILCCLCRRSSDHQGEQSPVEFNTLQPEVDNGCEVKSEEKANFTALQLIK
TEW
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagagcggtggcaggggaaacacgtgcgactacagccacaacgtcaccttcttctac
gattacgtaggtaaggagatcagcagagactggcgtgtcagggactgtgtggtagtggtc
ctgggcctgaccatctgcctcattatgatcctgtccaacataatggtgatggcggccatc
ttcatcaaccgacgcttccacttccccatctacttcctgctagccaacatggccgctgcg
gacctgttcgccggcatggcctacaccaacctcgtgctcaacacaggaccctggaccatc
aggctgtccaagcagcaatggttcattaggaatgctctggtggacatgagcctgacggcg
tctgtggccaacctgctggctgtggcggtggagcgtcaccagaccataattaccatgcag
ctgcacagcaagatgaccaaccggcgtgtggtgctgctgatcgtgtgcatctgggcagtk
tctatcatcatggggctgatcccttccatggggtggaactgtgagtgccagcttagcgac
tgctcaatcatcgccccgctctacagccgcaggtatatgatcttctgggcgtctctcaac
ctgctcaccttttctgtcatggtggctatgtacgcacgcatctatgtctacgtgagacgt
aagggtaaacggatgtctcagcacagctcccaccatctgaggcacaacgagactgtcttt
aacctcatgaagactatctctattgtactgggtgtgtttgtcatctgttggacgccgggc
ctgatgactctgttgctagatgggatcatgggtaaagacagccatgccttgacctatgag
aagtactgtctgatcctggctgagtgtaactccctggttaaccctattatatactccttc
cgggacgaggagatgagaaggacctttaagtgtatcctgtgctgcctgtgcaggaggagc
tctgaccaccagggggagcagtcccctgtggagttcaacacactgcaaccagaggtagat
aatggttgtgaagtaaaatcagaggagaaagccaactttactgccctccagctgataaag
acagagtggtga

DBGET integrated database retrieval system