KEGG   Salvelinus alpinus (Arctic char): 111980873
Entry
111980873         CDS       T05762                                 

Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04068  FoxO signaling pathway
salp04217  Necroptosis
salp04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111980873
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111980873
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111980873
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111980873
Transcription factors [BR:salp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111980873
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 PRKCSH-like Syntaxin-6_N
Other DBs
NCBI-GeneID: 111980873
NCBI-ProteinID: XP_023867686
LinkDB
AA seq 788 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAAQDGTTSHPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDMNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAMDFVQKNLTDDE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRTLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVIIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYILGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLFPEIPKEDAFGKYCRPEAAPEAELGDPCSTIQPYLKTKFICVTPCP
SVFMDFPDSELLGNGIFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGPLDSLTLDMEL
SSDVASPM
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggagaccaggtacctggagcagctgtaccac
ctgtacagcgacagcttccccatggagctccggcagttcctcgccccctggatcgaaagc
caggattgggcgtacgcagcgaacaaggagtcccacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagaacaaygtgctytaccag
cacaacctgcgrcgcattaagcagcacctgcagtccaagtacctggagaaacctatggag
atcgcccgcattgtggcccgctgcctctgggaagagcagaggctgctgcagaccgccacc
accgccgcacaggacggaacgacgtctcacccgtctggcactgtggtgacggagaaacaa
cagatcctggagcacaacctgcaggacatcaggaagagggtgcaggatatggaacaaaag
atgaagatgcttgagaatctccaggatgattttgacttcaactacaagacccttaaaagt
cagggtgagttgtcccaggacatgaatgggaacagccaggcagcagccaccaggcagaag
atgtctcagctggaacagatgctgagtgctctggaccagctcaggaggcaaattgtgact
gaaatggcagggctgctgtcagccatggactttgtccagaagaacctgaccgatgacgag
ctggctgactggaagaggaggcagcagattgcctgcatcggaggaccacccaacatttgc
ctggaccgcttggagacatggattacttccctggctgagtctcagctgcagatccgccag
cagatcaagaagctggaggagctccagcagaaggtgtcctataagggagaccccatcatc
cagcaccggcccgctctggaggagaagatagtggacttgttcagraccctcatgaagagt
gcgttcgtggtggaaaggcagccttgtatgcccatgcatccagacagaccactggtcatc
aagacaggtgtgcagttcaccaacaaagtcagattactggtgaagtttccagaattgaat
taccagctgaagatcaaagttattattgacaaggaatctggggacgtggctgccattcga
gggtcccgaaagttcaacatcctaggtaccaacaccaaggtgatgaacatggaggagtcc
aacaacggcagtctgtcagcagagttcaaacacctgaccctgagggaacagaggtgtggc
aatggtggcaggaccaacagtgatgcttccctgatcgttacggaggagctccacctcatc
acctttgagaccgaggtctaccaccagggcttgaagatcgacctggagacccattctcta
ccagtggtggtcatctccaacatctgccagatgcccaacgcctgggcctccatcctgtgg
tacaacatgctgaccaaccaccccaagaatgtgaacttcttcaccaagcctccggtgggg
acgtgggatcaggtagcggaggtgctgagctggcagttctcctccaccactaagagaggc
ctgaccatcgagcagctcaccaccctggctgagaaactactagggccgtgtgtgaactac
tctggatgccagatcacctgggccaagttctgcaaagagaacatggcgggtaaaggcttc
tctttctgggtatggctggacaacatcatcgacctggtcaagaagtacatcctggctttg
tggaatgaagggtatattctgggtttcatcagtaaggagagggagagggccatcctgagc
cctaagcctcctggcaccttcctgctgcgcttcagtgagagcagtaaggagggaggcatc
accttcacctgggtggagaaggacatcagtgggaagactcagatccagtcggtggagcct
tacaccaagcagcagctcaacagcatgtcctttgcggagatcattatgggatacaagatc
atggacgccaccaacatcctggtgtctccgctggtctacctcttcccagagatccccaag
gaggacgccttcgggaagtactgccgaccggaagctgctccagaggctgaactcggagac
ccgtgtagtaccattcaaccatacttaaagacaaagttcatctgtgtaaccccgtgccct
tccgtgttcatggactttccggacagcgagctgcttgggaacgggatattccctggcact
aactctggtaacaccagtgacctgtttcccatgtcccctcgcaccctggactcgctgatg
cacaatgaggctgaggccaaccctggcccactggactccctcactctggacatggagttg
agttctgatgtggcgtcacccatgtga

DBGET integrated database retrieval system