KEGG   Salvelinus alpinus (Arctic char): 111981132Help
Entry
111981132         CDS       T05762                                 

Definition
(RefSeq) low-density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111981132
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111981132
Membrane trafficking [BR:salp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    111981132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL hEGF DUF4448
Motif
Other DBs
NCBI-GeneID: 111981132
NCBI-ProteinID: XP_023868057
LinkDB All DBs
AA seq 837 aa AA seqDB search
MGRLLCVLLVFLACCVVQTNAETVCRIRQFLCGNGKCITLRWVCDETDDCGDGTDELPGT
CSARTCRTTEFSCGGRLNQCVPSTWLCDGKADCENGADEESCAPKXCTDNKFRCSNGQCV
SASFVCDEELDCDDGSDEASCPPTTCSSTSFQCNNSVCVPRLWACDGDXDCSDGSDEWPQ
XCGTRAXEXAPKXCSLREFQCGSGECIHXSWXCDGGFDCLDRSDETNCSRLTCRPDEFQC
GDGTCIHGSRQCNRQYDCRDLSDEIGCVNVSHCKGPTRFKCRSGECISMEKVCDKQRDCR
DWSDEPLRECDSNECLYNNGGCSHICNDLKFGYECQCPTGYYLTDKKRCEDIDECANPDI
CSQICVNHMGSYKCECEEGYQVDPATKACKAIGTVAYLFFTNRHEVRKMTLDKSEYTRVI
PRLKNAVALDMNMVAKEIYWSDLSQKKIYSTSIDLAADTAQHKVVIDSDIEAPEGIAFDW
VHGNIYWTDSIRSSISVSTANGSRRKTLFQNDLAKPRAIVVDPHSNFMYWTDWGTPAKIE
KGGLNGGDRAALVTDNIVWPNGITLDLLNQRLYWVDSKLHTLSSIBVQGGGRRTLIIDEH
RLAHPLGITVFEERVFWTDVSNNAILSANRVTGRDIKPVAEHLVSPEDIVLYHNLKQPTG
RDWCKVANGGCEFMCLAAPQVGIHSPKYTCACPDNMLLAKDMRKCVPAAPTPAXPVKPIV
PXXNPPPPDRPRIPQAQTTTMPQVTTQDIRHEFAAIPTAPSTPAALYIALPIAIVCLVAF
GAVLLWRNYRLKNTNTIHFENPVYQKTTEDQVHICRSHSPDGYSYPPRQIVSLDDEA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctgctgtgcgtgctgttggtattcctggcttgctgtgttgtccaaacaaac
gcagagacagtatgcaggatcaggcagttcctgtgtgggaatgggaagtgcattacactg
agatgggtgtgtgacgaaacagatgattgtggagatggaactgacgagctccccggaacc
tgctcggccagaacatgcagaaccacagagtttagctgtggtggacgtctgaaccagtgt
gttcccagtacctggctctgtgacggcaaagcagactgtgaaaatggagctgatgaggag
agctgtgcgcccaagcrctgcacagataacaaattccgctgcagtaacggccagtgtgtg
tcrgcctcytttgtgtgtgatgaggagttggactgtgatgacgggagcgacgaggcttcc
tgcccacccaccacctgtagctccacctccttccagtgcaacaactctgtgtgtgtgccg
cgcctrtgggcctgcgacggagacrytgactgctcggatggctccgaygagtggccccag
arctgtgggacgcgagccsctgagrgtgcccccaagycctgctcccttcgggagttccaa
tgtggcagcggggagtgtatccacrgcagctggraatgtgatggagggttcgactgcctg
gatcgctctgacgagaccaactgtagccgcctcacctgccgccccgatgagttccaatgc
ggtgatggcacctgtatccacggcagccgccaatgtaaccgccagtacgactgcagagac
ttgagtgatgaaataggctgtgtcaatgtgagccattgcaagggtcccaccaggtttaag
tgccgtagtggggagtgcatcagcatggagaaggtgtgtgacaagcagcgtgactgcagg
gactggtcagatgagcctctcagagagtgtgattccaacgagtgcctgtacaacaatggc
ggctgctcacacatctgcaatgacctgaagttcggctatgagtgccaatgccccaccggc
tactacctgacggacaagaaacgctgtgaagatatcgatgagtgtgccaacccagacatc
tgcagccagatctgtgtcaatcatatgggcagctacaagtgcgagtgtgaggagggctac
caggtcgacccagccacwaaagcctgcaaggccatcggcactgtagcctatctgttcttc
accaatcgccatgaggtgaggaagatgacactggacaagagtgagtacacgcgtgtcatc
ccccgcctgaagaatgcagtggctctggacatgaacatggttgccaaggagatttactgg
tctgacctctcccagaagaagatctacagcacctcaatagacttggctgcagacacagcg
caacacaaagttgtgattgacagcgacatcgaagctccggagggcatcgcctttgactgg
gtccacggcaacatctactggaccgacagtatccgcagcagcatctccgtgtcaaccgcc
aacgggagccgccgcaagactctcttccagaatgacctggccaagccccgcgctattgtg
gtcgacccccacagcaayttcatgtactggactgactggggaactccagccaagattgag
aagggaggtctgaacggaggagaccgtgctgctctggtcacagacaacattgtgtggccc
aatggaatcacccttgacctgctgaaccagcggctgtactgggtggactccaagctgcac
accctctccagtatcracgtccagggtggtggccgaagaacactcattatagatgaacac
aggctagcccatcccctaggcatcactgtgtttgaggaaagagtgttttggacagatgtc
agcaacaatgccattctgagtgccaaccgtgtgacaggcagggacatcaagcctgtggca
gagcacctggtatccccagaggacattgtgttgtaccacaacctcaaacagccaactggc
agggactggtgcaaggtggccaacggaggctgtgagttcatgtgtctrgcagccccccag
gtgggcatacattcccccaagtacacctgtgcatgccctgacaacatgctgctggccaaa
gacatgagraaatgtgtaccagctgcaccaacacctgcarctccagtcaagcccattgtt
cccrccyccaaccccccaccgccagatagacccaggatcccccaggcccagactaccaca
atgcctcaagtcaccactcaggacatccgccatgaatttgctgctatacccacagcccct
tcaacccctgcagctttatacatcgcgctgcctatagccattgtgtgtctggtggccttt
ggtgcagtgctgctgtggaggaactacaggctgaagaacactaacaccattcactttgaa
aacccagtctaccagaagaccactgaagaccaggtgcacatatgcaggagccacagtcca
gacggctactcctacccaccgagacagattgtgagtcttgatgatgaggcttga

DBGET integrated database retrieval system