KEGG   Salvelinus alpinus (Arctic char): 111982123Help
Entry
111982123         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC111982123
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00310  Lysine degradation
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111982123
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:salp03036]
    111982123
Enzymes [BR:salp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     111982123
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111982123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 111982123
NCBI-ProteinID: XP_023869463
LinkDB All DBs
AA seq 1732 aa AA seqDB search
MDGCSKMSVMELCETDDLATSLVLDPLLGFSTHKMNVSPPPEVRRWGYLKETLLRFQRTH
DFQATFEALTVGDWACDYFTGLGTHRLELLKQHVYRXLCAFLLDSGVQIESCDRYSSETN
GAKITSTKHWFVGERMEVLLGCIAELSPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGGCVKVVRPIAPGEEITCYYGDSFFGEDNEMCECCTCERKGE
GHFRHRERQPGCDDSNDLSGQKYRLRDTDLRLNRGKAPCPPTFRPTFTFSNSAIPSRNSF
TQQMKRNALMMSRKTKRLKQEGQRRISXMKQQRLIMPSLSEVVLRNLRVRVRRHTFNFLL
SCKDPTSKERALLHQLEHVETKDKWRKEQSALCCTTKENDKKEKSSNTCELNLKPFTLXP
SLSSQQNAGPAVCGQILGGKPLRVVEKVSVQTRISSRTRSMIRNCHTRXSVSRAKKNNKI
ISKRIELTKPICRKSNSASPQKHMDSCSGKDATHNVIKDIHGTNCITIENNTSGNNNDVA
YISNRTYTGGGGPKGSKAQXADQKPVDLKVEIKTIGESGTDGTLVASKPSGKRVEVCQSA
LDKAXKPGNHQKPISTPLVTTTPRTISLSSPSLDHVPLMSGLKQVTVSLIRVSVPXSVAE
ERACPGLEGKGIVRRESSVPVQAEQMARSATQGGEADTRVSRSQQKSMEEAGRELSDAEG
KKGVREMYFKAKINKADVGRGQTAVVKVDJLHGEKGAGEKVIEIEAAGGGEKVSVAGKXH
RGSVKXIDRGAKLNSKSVQSQXVGCDKRVLRGRNDAEEQSNGKAGGQNSKSCDSIIRKDG
GKNERVSEMVKKGSSITMDKKGVVIKQVRVLLSDILRKERDQKAGGSGSGNTGKKDLISS
NHKQMEDGREANNDGGKEVREQILSDAQTNSLPHATTQSGIISKRGKGRASKMKLEGPGQ
DLHIHSPQSNDDLIPAKDRLSKSPPPSSEYLQTHTQANIPLKKRMFRNSVETDSEQSINS
PVSEPSSKDLKPSTGLRQNLTLCSGRETKAIKVLEDCGRGGLRSNSDPKSTVSEFGVQSR
TQTFKRTAKQNATPRMLRPRVNQLEQDRPRRSAGKYKRGTRDSEVLENESDEDKHKAGHG
EISLDSKKEHVXEGEKKPESHTELLNSLTSQTYKEENGKGQSLNFKIRFKRKRGKVWELD
RPAGGEDLIIEAEKSIDSQQLEPYRAILDSVSILNLEMEKGAQADGKETHDVRFWKRRKV
RRDRLGSLKDKGPILMNRQSEVVAVDSKEKKKXQGELSEVEINEVLDEVIYGVKQLPGEK
GHTITSEGMSVGVGGLQCDYQVTPSPVRICGKEKDIPSLAEDREQVKDTCIGVESSLVDS
GALHEHKVKDEDQPLPRIKLRRKIQGVWEVDSQELEQIEAESEKEKKEITCVKXKEECPS
QXPTCQKLNSAIKCNTLKDSSAVLLKKEPPPLTLSLSPLTLNSPQPVGSDVMAYAPETMN
DRAMPKITNRGGRGRGRGRKERQKTETARKVATGEMGTSCLSHNLLQIDNSLSRLSEGLC
QSQSLEKNIPSDYTASTSKIPSQSQSPPFSFPERMLSTESSFANCCEDLLDFQCLNLEGF
YHPQNILQTSPIDLCPMDPPSGPFSSPLSHSPSDAWNPETPYLGPPRPGSIFNAEDQQFL
NGLVCSKNESLPLDCGVKDTSKDRGQLNANFCFTPLCSAEDFHGSFFDENPG
NT seq 5199 nt NT seq  +upstreamnt  +downstreamnt
atggacggatgcagtaaaatgagtgtgatggagctgtgtgagacggatgatctggccacc
agcttggtyctggaccccttgctggggttcagcacccataaaatgaacgtcagtcccccc
ccagaggtccgtcgttggggctacctraaagagactctgctacgcttccaacgcacacat
gacttycaggccacctttgaggcrctcacagtgggagactgggcctgtgactacttcact
ggactgggaacacaccgtctggaactactgaaacagcatgtgtatcgctarctctgtgcc
ttcctgttggatagtggtgtccagattgagtcatgtgaccgatactcttcagaaaccaac
ggagcaaagataacctctaccaagcactggtttgtwggtgagcggatggaggttctgttg
ggttgtatagccgagctgagtccagcagacagtgctgttctgagagcaggggtgaatgac
tttagtgtgatgtactccactcgtaagcgctgtgcacaactctggcttgggcctgcggct
ttcatcaaccacgactgcagaccyaactgtaagtttgttcctggcgataagaatggaggc
tgtgtaaaagtggtgaggcccatcgcacctggggaggagatcacctgttactatggcgac
agcttttttggagaagacaatgaaatgtgtgaatgctgcacctgtgagagaaaaggagag
ggtcacttccgacacagagagaggcagcctggttgtgatgactctaatgacctgtctggc
cagaagtaccgcctcagagacacagaccttcgtcttaacagagggaaagcaccctgtcct
cctacatttcggcctacatttacattttcaaattcagctatcccttcaaggaattcattt
acccagcagatgaagagaaatgctctgatgatgagcaggaagaccaaaaggttgaaacag
gaggggcaaaggaggatatcggyaatgaagcagcaacggctgataatgccatccctatca
gaggtggtgttgaggaaccttagggtccgagtacggcgccacacgttcaacttcttgttg
agctgcaaggaccccaccagcaaagagagggccttgctgcaccagcttgaacatgtggag
acaaaagacaagtggaggaaggaacaatctgctctctgctgtacaaccaaagagaatgac
aaaaaagagaagagcagcaatacttgtgagttaaacctgaagcctttcactcttcakcct
tccttgtcttctcaacagaatgctggaccagcagtttgtggacagatactgggtggaaag
ccccttcgagtggtggaaaaagtatctgtccagacaaggatctcttccagaacaaggagc
atgatcagaaactgtcacacacgcrcgtctgtttccagagccaagaagaacaacaaaatc
attagcaagcgcattgaactcaccaaaccratttgcagaaaaagcaacagcgcaagtcct
cagaaacacatggatagctgtagtggaaaagatgccacgcacaatgttatcaaagatatt
catggaaccaattgcataaccatcgaaaataacaccagcggcaacaacaatgatgtggca
tacatcagcaacagaacatacactggtggaggcgggcccaaaggcagcaaggctcagkat
gcagatcagaaaccagtggatctgaaagtggaaatcaaaaccattggagaatcggggact
gatgggacacttgtggcgagcaaaccctctggtaaaagggttgaagtttgccaaagtgct
ttggacaaagccaamaagcctgggaatcaccagaaacccattagtactccccttgtcact
accacccctagraccatttctctctcttccccctcacttgaccatgttccaytaatgtca
ggactgaagcaagtcacagttagcttgataagagtgtctgtgccggyaagtgtagcagaa
gaaagggcctgtccaggattggagggaaagggcattgtgagaagagagagcagcgtacca
gtgcaagcagaacagatggctagatcagctacacagggaggagaggcagacaccagagtg
tccaggtcccagcagaagtccatggaggaagcaggcagagagttgtcagacgctgaaggt
aagaaaggggtgagggaaatgtatttcaaggctaagattaacaaagctgatgtaggaagg
ggacagactgctgtggtgaaggtrgatmtwttacatggtgagaaaggggcaggtgagaag
gtrattgaaatagaagctgctggtgggggggaaaaggttagtgtggctgggaagyggcat
agggggagtgtaaaamacattgacagaggggcaaaactaaatagtaaaagtgtacaatct
caaytmgttggctgtgataagagggtgcttagagggcgaaatgatgcagaagaacagagt
aatggaaaagcaggaggacaaaatagcaaaagttgtgacagcattatcagaaaggatgga
ggtaagaatgagagggtgtctgaaatggtaaaaaaggggagtagtataactatggacaag
aagggtgttgttatcaaacaggtgagggttctactttctgatattctaagaaaagagcgg
gatcagaaggctgggggctcaggaagtgggaacacaggaaagaaagatctaatttcctcc
aaccataagcaaatggaagatggcagagaggcaaataatgatggggggaaagaggttagg
gaacaaatattatctgatgcacagacaaatagtttgcctcatgcaacaacacaaagtggg
ataatttccaaacgggggaaaggaagggctagtaagatgaaacttgagggtccaggtcaa
gacttgcatattcactcgccacaaagtaacgatgatttaatcccagcgaaagataggctt
tccaagtctccccctccttcttcagaatatcttcagacacacacccaggccaacattcct
ctgaagaaacggatgttccgtaattcggtggagactgactctgagcagagcatcaactct
cctgtgtcagagccatcctccaaggacctcaaaccctccacagggctgaggcagaatctg
actctgtgttccggaagagaaaccaaagctatcaaagtgttggaggactgtggtagaggt
gggttgcggtctaatagtgaccctaagtctaccgtttcagagtttggggtccaatctcgg
acacagaccttcaagaggacagcaaaacaaaatgcaacgcccagaatgctgcgtcccaga
gtcaatcaactggaacaagaccggccacggaggagtgcaggyaagtataaaagagggacc
cgkgactcagaggtactggagaatgaatctgatgaggacaaacacaaagcaggacatggt
gaaatctcactggattctaaaaaagaacatgtaaamgaaggagagaagaagccagaatca
catactgagttactgaattcactcacctcgcaaacatacaaggaagagaacgggaaaggg
cagagcctcaacttcaaaatccgttttaagagaaagaggggcaaagtgtgggagttggac
agacctgcaggaggagaggatttgattattgaagcagaaaagtctattgattcacaacaa
ttggagccttatagggccattttagattctgtgtcaatcttaaacttagaaatggagaag
ggtgcccaggcagatgggaaggagactcatgacgtacgattttggaagagacgtaaagtt
agacgagacagattggggagtttgaaagataaaggtcccattttgatgaacaggcagagt
gaggttgtagctgtagactcyaaagagaaaaaaaagyaacagggggagctcagcgaggta
gagataaatgaggtgttagacgaggttatttatggagtaaagcaactaccaggagaaaag
ggccatacaattactagtgagggtatgtctgtcggagtggggggactgcaatgtgactat
caagtcacaccaagtcctgttagaatctgtggaaaagagaaagatattccatccttggct
gaagacagagaacaagtgaaggatacttgtattggagtagagagtagtttggttgacagt
ggggcactgcatgaacacaaagtaaaggatgaggaccaacccttgccacggatcaaactg
cggagaaaaatacagggtgtatgggaggtygacagccaggagttggagcagattgaagca
gagtctgaaaaagagaagaaggaaatmacatgcgttaagcraaaagaagagtgcccttct
caarctcccacctgccagaaactcaacagtgcaatcaagtgcaacactttaaaagattcc
tctgctgttcttctgaaaaaagaacctccccccctcactttatctctctcacccttgacc
cttaactcacckcaacctgtgggttctgatgtgatggcctatgctcctgaaacaatgaat
gacagggccatgccaaaaatcactaataggggaggaaggggaaggggaaggggacggaaa
gaaaggcagaaaacagagactgctcgtaaggttgcaactggagagatgggaacttcttgt
cttagtcataacctgctacagatagacaacagtctttctagactctcagaagggttatgt
cagtcacaatccttagaaaaaaacataccttctgattacactgcttccacctcaaagatt
ccatcccagtctcagtctccaccgttcagttttccagaaaggatgctttccacagaatcc
agctttgctaattgctgtgaagatctcctcgacttccagtgtctcaatcttgaagggttc
tatcatccacagaacatcctccaaacctctccaatagacctctgtccaatggatccaccc
agcgggccctttagtagtcccctctctcatagcccctcggatgcttggaacccagaaacc
ccataccttggccctccaagrccaggaagtatcttcaatgcagaggatcagcaatttctt
aatggtcttgtgtgctccaaaaatgagtctctccctttggattgtggagttaaggatact
tccaaagacagaggacagctcaatgcaaatttttgttttacacccctttgcagcgctgag
gactttcatggatcgttttttgatgaaaatcctggatga

DBGET integrated database retrieval system