KEGG   Salvelinus alpinus (Arctic char): 111982354Help
Entry
111982354         CDS       T05762                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00010  Glycolysis / Gluconeogenesis
salp00051  Fructose and mannose metabolism
salp00052  Galactose metabolism
salp00500  Starch and sucrose metabolism
salp00520  Amino sugar and nucleotide sugar metabolism
salp00524  Neomycin, kanamycin and gentamicin biosynthesis
salp01100  Metabolic pathways
salp01200  Carbon metabolism
salp04910  Insulin signaling pathway
Module
salp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
salp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111982354
   00051 Fructose and mannose metabolism
    111982354
   00052 Galactose metabolism
    111982354
   00500 Starch and sucrose metabolism
    111982354
   00520 Amino sugar and nucleotide sugar metabolism
    111982354
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111982354
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111982354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111982354
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111982354
Membrane trafficking [BR:salp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111982354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111982354
NCBI-ProteinID: XP_023869681
LinkDB All DBs
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLHDIKCRFRRELENGLGRDTNTTAT
VKMLPTFVRSIPDGSEKGDFLALDLGGSNFRILRVKVTQDKKQPVQMESLVYETPEDIIH
GSGTQLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLVTWTKKFKVSGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTTGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDLRTEFDREIDRGSLNPGKQLFEKMASGM
FMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKCKEILTRLG
VEPSQEDCVAVQHVCTIVSFRSANLIAATLGGILARLKDNKGVARLRTTVGIDGSMYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSAKGAAMVTAVAYRLADQTRQIAQTLAEFRLS
KAQLLEVKKRMRTEIENGLGKKTHDSATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKSARLPLGF
TFSFPCHQKSLDAGILVNWTKGFKCTDCEGEDVVELLREGIKRKEEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIETVEGNEGRMCVNMEWGAFGDNGCLDD
IRTQYDCAVDENSLNEGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGKISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCSTVSRRAAQICGAGMAG
VVDKIRENRALDHLDVTVGVDGTLYKLHPHFSRIFHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRQRAQEALQA
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggcacagcttctggcatattacttcactgagctgaaggatgaccaggttaag
aagatcgacaagtacctttactcyatgcgtttctctgacgagacgctgcatgacatcaag
tgtcggttccggcgggagctggagaacgggctgggccgcgacaccaacaccaccgcgacc
gtcaagatgctgcccacctttgtcaggtccatccctgatggatcagaaaagggggatttc
ttagctctggatctgggtggctccaacttccgtatcctgcgcgtgaaggtgacacaagac
aagaagcagccggttcagatggaaagcctggtctacgagacccctgaggacattatccat
gggagtgggacgcagctctttgaccatgtcgcagaatgccttggtgacttcatggagaag
caaaagatcaaggataaaaaactccctgtaggattcacattctccttcccatgtgcacaa
accaaactggacgaggccgtcttagtgacttggacaaagaagttcaaagtgagtggtgta
gaaggcatggatgtcgtgaagcttctgaacaaggccatcaagaaacgaggggactatgaa
gctgacatcatggcagtggtcaatgacacaaccggaacgatgatgacctgtgggttcgac
gatcaacgatgtgaagttggcatcatcataggtactggtactaatgcctgctacatggag
gagctgcggcacattgacctggtggagggagacgagggcaggatgtgcatcaatacagag
tggggggcgttcggggacgacgggtccctggaggacctccgtacagagtttgaccgggag
atcgaccgaggctccctcaaccctgggaaacagctgtttgagaagatggccagcgggatg
ttcatgggagagctggtccgcctcatcctggtcaagatggccaaggagggactgctgttc
gagggtcggataaccccmgagcttctgacaaaagggaagatcgaaactaagcatgtttca
gccattgagaagagcaaggaaggcctgaccaaatgcaaagagattctaacgaggcttggt
gtggagccttctcaagaggactgtgttgcygtgcaacacgtgtgcaccatcgtatccttc
cgctctgcraacctcatcgcagctacactaggaggtatccttgctcggctgaaggacaac
aagggagtcgcccgcctgcgcaccactgtgggcattgatgggtcgatgtacaagatgcac
cctcaatacgcccggcgtctccacaagacggtgcggcgtttggtgcccgactctgatgtc
cgtttcctgctgtccgagagcggaagtgccaagggtgctgccatggtgacggcggtggcg
taccgtctggccgaccagacacgccagatcgcccagacactggccgagttccgtctgagc
aaagcccagctgctggaggtgaagaaaaggatgaggacggagatcgagaacggcctgggg
aaaaagactcacgactcggccaccgtcaagatgctgcccacctacgtgcgcagcacgcct
gacggaacagaaaatggggatttcctggctctggatctgggagggacaaacttccgggtc
ctgctggttaagatccgtagtgggaaaaggcgtacagtggagatgcacaacaaaatctac
gccattcccatcgaggtcatgcagggcacgggagaggagctctttgaccacattgtgtac
tgcatctctgacttcctggactacatgggcatgaagagcgcccgtctgcctctgggcttc
accttttccttcccctgccaccagaagagcctggatgcgggtatccttgtgaactggacc
aaaggcttcaaatgcacagactgtgagggtgaagacgtggtggagcttctccgggagggc
atcaagaggaaagaggagtttgatctggatgtggtagctgtggtgaacgacactgttgga
acaatgatgacgtgtgcatatgaagagcccacctgtgagattggacttattgcagggacg
ggcagtaacgcgtgttacatggaggagatgaggaacatagagacggtggaggggaacgag
ggacgcatgtgcgtcaacatggagtggggtgccttcggggacaatgggtgcctggacgat
atcaggacgcagtacgactgcgccgtggacgagaactcactcaacgagggcaaacagagg
tatgagaagatgtgtagcggcatgtacctgggagaaattgtgaggaacatccttattgac
ctgaccaagcgtggcttcctgttccgtggaaagatctctgagacgctgaagaccagaggc
atctttgagaccaagttcctgtcccagatagagagcgatcgcctggccttgctgcaggtc
agggccatcctacagcagctgggtctggacagcacatgtgacgacagtatcatcgtcaag
gaggtatgcagcaccgtgtcccgccgtgcggctcagatctgcggagccggaatggccggt
gtggtggacaagattcgcgagaacagagcgctggaccacctggacgtcactgtgggggtg
gacggaacactctacaaactgcacccacacttttcccggatcttccaccagacagtgaag
gagctcgctcccaagtgtaacgtcaacttcctgttgtcggaggatgggagcggcaagggt
gcagccctcatcacagccgtgggctgtcgccagagagcgcaagaggcgctgcaagcgtaa

DBGET integrated database retrieval system