KEGG   Salvelinus alpinus (Arctic char): 112068054Help
Entry
112068054         CDS       T05762                                 

Gene name
dnmt3a
Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00270  Cysteine and methionine metabolism
salp01100  Metabolic pathways
Module
salp_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    112068054 (dnmt3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:salp03032]
    112068054 (dnmt3a)
   03036 Chromosome and associated proteins [BR:salp03036]
    112068054 (dnmt3a)
Enzymes [BR:salp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     112068054 (dnmt3a)
DNA replication proteins [BR:salp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    112068054 (dnmt3a)
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    112068054 (dnmt3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 112068054
NCBI-ProteinID: XP_023990831
LinkDB All DBs
Position
Unknown
AA seq 1001 aa AA seqDB search
MPSNTVATTNTAAFKNSDYTCDAPGNRMSETTILDKELAPEEKPAKSNSSCKVVRPAGRK
RKQIPVEGSVSVKESVAGGVCNSRTGLAAERERQSVCVAQVHNGVVSSGHADRDRTQAGA
RCCPKQDRKASEKNGLPGAPGTPSSPASRTEDAPPGPHTLLCQSRILSPPSLENGFLLSR
EPSRDEQDDSEKDKEETLPTPPRKKRGRRKLERPTKYVEQKEEDGEDTTKNEGVGGPGTG
RLRGSVSLRQRPMPRVTFQAGDPYYISKRTREEWLAKWKMEAEKKALLVSVMNAMEDHEM
EPEPQQKEEVSVITHNQQQQQQQQQQQQQQQPTNPASPTVATTPEPVAMAGGDKTSPKTA
DTEPEYEDGRGFSIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSV
VCVEKLLPLSSFSNAFHQPTYSKQPMYKKAIYEVLQVASTRAGKAFIACPESDGTDTSKS
VDLQSKQMIEWAKTGFQPTGPKGLEPPEEERNPYKEVYPDVWVEPEAAAYTPPPAKKPRK
STAAEKPKVKEMIDEGTRERLVYEVRQKCRSIEDICISCGSLNVSREHPLFAGGMCQSCK
NCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQIAIKE
DPWSCYMCEKGQKGVFGLLERRTDWPCRLQHFFANNHDQDFEPPKLYPPVMAEKRQPIRV
LSLFDGIATGLLVLKELGIQVERYVASEVCEDSVTVGIVRHQGRIMYVGDVRNVTRKHLH
EWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHEARPKEGDNRPFFWLFE
NVVAMGVSDKRDISRFLECNPVMIDAKEVSAAHRARYFWGNLPGMNRLVRERPLTAMCTD
RLDLQECLEHGRTAKFGKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFP
VHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacactgtcgccaccaccaacaccgccgcattcaaaaactccgactacacc
tgtgatgcacctgggaacagaatgagtgagaccacgatactggacaaggagctggcacca
gaggagaagccagctaaaagcaacagcagctgtaaagtggtcaggcctgctgggaggaaa
cgcaagcagatacctgtggagggcagtgtgtctgtgaaggagagtgtggccggaggtgtg
tgcaacagtcgcactgggctggcagcggagagagagagacagtccgtgtgtgtggcgcag
gtgcacaatggagtcgtgagcagcgggcacgcagacagagacagaacccaggctggtgct
cgctgctgccccaagcaggacaggaaagcttcagagaagaacgggttaccaggcgcccct
ggtacccccagttcccctgccagccggaccgaggacgccccacccggaccccacaccctc
ctatgtcagagccggatcctgagtcccccctccctggagaacgggtttctactgagccgg
gagccgagccgggacgagcaggacgactctgaaaaggacaaagaggagactctgccaact
ccgccgcgcaagaaacgaggcaggcggaaactggagcgcccaacgaaatatgtggagcag
aaggaggaggatggagaggatacaaccaagaacgagggagttggaggccctgggacaggc
aggctgcgtggctccgtcagtctgcgtcagaggcccatgcccagagtaaccttccaggcc
ggtgacccatattacattagcaagaggaccagggaggagtggctggctaaatggaagatg
gaggcagagaaaaaggccctgctggtgtcagtgatgaacgcaatggaggaccatgagatg
gagcctgagccacaacaaaaagaagaagtgtcagtaatcacacacaaccaacaacaacag
caacaacaacagcaacaacaacaacagcagcagcccacgaacccagcgtcccctacggtg
gccaccacacctgaacctgtcgccatggcaggaggtgacaagacatcacccaagacagct
gatactgagcctgagtacgaggatggccgtggtttcagcattggggagctggtgtggggg
aagctgagggggttctcctggtggcctggtcgtattgtctcctggtggatgaccggacgc
agccgagctgccgaggggacacgatgggtcatgtggttcggtgacggaaaattctctgtg
gtgtgtgtagagaaactgttgcctttgagttccttctccaacgccttccaccagcccacc
tacagcaagcagcccatgtataagaaagccatctacgaggtgcttcaggtggccagcacc
cgagcaggcaaagcctttatagcctgtccggagagcgatgggacagacacctccaagtca
gtggatctacagagcaaacagatgatcgagtgggctaagacaggcttccaacccaccggg
cctaagggcctagagccaccagaagaggagcgtaacccatataaggaggtgtacccagac
gtgtgggtggagccagaggcagcggcctacacgccccctccagccaaaaagcctcgcaaa
agcactgcagccgagaaacccaaggtcaaggagatgattgacgaggggacgagagagaga
cttgtgtacgaagtgagacagaaatgcagaagcatagaagacatctgcatctcctgtgga
agtttgaatgtttcccgtgaacaccctctatttgctggaggaatgtgccaaagctgtaag
aactgctttctagaatgtgcttatcagtatgatgacgatggttaccagtcatactgcact
atttgctgcgggggacgagaggtgctcatgtgcgggaacaacaactgctgcaggtgtttc
tgtgtggagtgtgtggacttgttggtgggcccaggtgcagcacagatagctattaaagag
gatccctggagctgctacatgtgtgagaagggacagaagggagtgttcggcctgctggag
cgtcgcactgactggccctgccgtctacagcacttcttcgctaataaccatgaccaagat
tttgaaccaccaaagctttaccctccagtcatggcagagaagagacaacccattcgtgtc
ctgtcactgttcgatggcatagcaacaggtctgctggtgctgaaggagctgggtatccag
gtggagcgctatgtggcgtcggaggtgtgcgaggactccgtcacggtgggcatcgtcagg
caccagggacgcatcatgtacgtgggcgacgtgaggaacgtcacacgcaaacatttacac
gagtggggcccctttgacttagtgattggtggaagtccatgtaacgacctctctattgtc
aacccggctaggaagggtctttatgagggcactggtcggctgttctttgagttctaccgt
ctgctgcacgaggctcggcccaaagagggcgacaaccggccgttcttctggctctttgag
aatgtggtggccatgggcgtcagcgacaagagggacatctctcgctttctagagtgtaac
ccggtgatgatcgatgccaaggaggtgtctgctgctcaccgcgcccgctacttctggggg
aacctgcctggcatgaacaggttggtgagagaacgacccttgactgccatgtgcactgac
agactggaccttcaggagtgtttggagcatggcagaacagcgaagtttggcaaagtgagg
accatcaccactcgctctaattccattaagcagggtaaagaccagcacttccctgtcttc
atgaacgagaaggaggacattctctggtgcactgagatggagagggtgtttggcttccct
gtccattacacagacgtgtccaacatgagtcggctggccaggcaaaggcttctgggaagg
tcgtggagtgtaccggtcatccgtcacttgtttgcaccactcaaagagtactttgcctgt
gtttaa

DBGET integrated database retrieval system