Salvelinus sp. IW2-2015 (Arctic char): 112068944 Help Entry 112068944         CDS       T05762                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism salp  Salvelinus sp. IW2-2015 (Arctic char) Pathway salp00670   One carbon pool by folate salp00790   Folate biosynthesis salp01100   Metabolic pathways salp01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:salp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     112068944    00670 One carbon pool by folate     112068944 Enzymes [BR:salp01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      112068944 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  112068944 NCBI-ProteinID:  XP_023991949 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MSRVLNCIVAVCPDMGIGNNGNLPWHPKRLNNEFKYFQKMTMTSSVEGKQNVVIMGRKTW FSHSRANRPLKNGINIVLSRELK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctcgtgtgctgaactgcattgtggctgtttgtcctgatatggggattggaaataac gggaatctaccttggcacccgaagagactcaataatgaatttaagtatttccagaagatg acaatgacgtcttcagtggaaggtaaacagaatgttgtcatcatggggcggaagacatgg ttctcccattccagagcgaaccggccactcaagaacgggatcaacatcgttctcagcaga gaacttaagtaa

DBGET integrated database retrieval system