KEGG   Salvelinus alpinus (Arctic char): 112068963Help
Entry
112068963         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00020  Citrate cycle (TCA cycle)
salp00190  Oxidative phosphorylation
salp01100  Metabolic pathways
salp01200  Carbon metabolism
Module
salp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
salp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112068963
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112068963
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112068963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA
Motif
Other DBs
NCBI-GeneID: 112068963
NCBI-ProteinID: XP_023991980
LinkDB All DBs
Position
Unknown
AA seq 657 aa AA seqDB search
MASVSRVLTKRILSTKAFPAATRCSSRNIHFSIYGKKDNAKVSDDISTQYPVVDHEFDAV
VVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMXGDDWRWHFYD
TVXGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFXGQSLNFGKGGQ
AHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMRXCECRGVIALCMEDGSIH
RFRXNNTVIATGGYGXTYLSCTSAHTSTXDGNAMVTRAGLPCQDLEFVQFHPTGYLWCRC
LITEGCRGXGGILINSEGERFMERYAPNAKDLASRMWCHAPXPLIREGRGCGPEKDHVYL
QLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMXGIPTNYKGQVITHPD
GRTMVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIADTCTPGEKLSPLKPS
AGEESVANLDKIRFADGNTRTSEIRLNMQRTMQNHAAVFRTGDVLKEGCDKMDAIYQTME
DIKTFDRGMVWNTDLVESLELQNLMLNAVQTIHSAEARKETRGAHAREDYKERMDELDYA
RPLAGQERKPFQQHWRKHTMSTVDPKTGKVTLEYRPVIDTSLDQEECSAVPPAIRSY
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgtatccagagtcctgaccaagaggattttatcaactaaagccttccctgca
gcaacccgatgcagctccaggaacatccacttctccatctatgggaagaaggacaacgcc
aaagtgtcagatgatatctcaacccagtacccggtagtggatcatgagtttgatgcggtg
gtggtaggggctgggggagcaggtctgagagctgcttttggtctgtctgaggctggcttc
aacacggcctgtgtcaccaagctgttccccactaggtctcacactgtggcagcacagggt
gggatcaatgcagccctgggtaacatgngaggagatgattggaggtggcacttctacgac
acagtgnaaggatctgattggctaggggaccaggatgctatccactacatgacagagcag
gccccagctgccgtggtggagctggagaactttggaatgcccttcagtcggacagaggat
gggaagatctatcagagggccttcnggggtcagagcctgaattttggaaagggaggccaa
gcacaccgatgctgctgtgtagctgacaggactggacactcccttcttcacacattgtat
ggacggtccttaaggtatgataccagctactttgtggagtactttgccctggacctgctg
atgaggnnatgtgaatgcagaggagtgatcgctctctgtatggaggatggatccatccac
cgcttcaganccaacaacactgtcatcgctactggtggttatggcnngacctacctcagc
tgtacctcagcccacaccagcacgnnggatggcaacgccatggtaaccagagctggccta
ccatgccaggacctggagtttgtacagttccaccccacggggtatctatggtgccgctgc
ctcatcactgagggttgccgtggcngaggagggatcctcatcaacagtgaaggagagcgc
tttatggaacgctacgctcccaacgccaaagatctggcctcccggatgtggtgtcacgct
ccatgaccattgatccgcgagggaaggggttgtggtccagagaaggaccatgtgtacctg
cagttgcatcacctgcctccccagcagctggccacccgcctgcctggtatctctgagacc
gccatgatcttcgctggggttgacgtcaccaaagagcccatccctgtcctgcccaccgtc
cactacaacatgnnaggaatccccactaactataagggacaggtcataactcatccagat
gggaggacaatggtgccagggctgtatgcctgtggtgaggctgcctgtgccagtgtccat
ggtgccaaccggctgggtgccaactccctgctggatctggtggtgtttggcagagcctgt
gccctcaccatcgctgacacctgcactccaggtgagaagctttccccactgaagcccagt
gctggagaggagtctgtggccaacctggacaagatcaggtttgctgacgggaacaccaga
acctctgagatcagactcaacatgcagagaacgatgcagaaccatgcagcagtgttccgt
accggtgacgttctgaaggagggatgtgacaagatggacgccatctaccagaccatggag
gacatcaagacattcgaccgtggtatggtgtggaacactgacctggtcgagtctctggag
ctgcagaacctgatgctgaacgcggtccagactatccactctgccgaggcccgcaaggag
accaggggagcacacgcccgggaggactacaaggagcgtatggatgagctggactacgcc
aggcctctggcaggacaggagaggaagcctttccaacagcattggagaaaacacacaatg
tccactgtggatcctaagactggcaaggtaactctggagtaccgcccagtgattgacacc
tctctggaccaggaggagtgttcagccgtccctccagccatccgctcctattga

DBGET integrated database retrieval system