KEGG   Salvelinus alpinus (Arctic char): 112069240Help
Entry
112069240         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: SWI/SNF complex subunit SMARCC2-like
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    112069240
   03036 Chromosome and associated proteins [BR:salp03036]
    112069240
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     112069240
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    112069240
   PBAF complex
    112069240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_1 SWIRM-assoc_3 Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 112069240
NCBI-ProteinID: XP_023992302
LinkDB All DBs
Position
Unknown
AA seq 1088 aa AA seqDB search
MAVRKKDGGPNVKYFETSDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGRHVSNPPLTRLPMKSFLDFKSGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPVIYLSSDIEAKLLGKLKDIIKRHQGSVTEDKTCSSHVVVP
IPASLEEEEWVRPVMKRDKQVLLHWGYSPDSYDTWILASEVEAAVEDPPSPEKPRKVHAK
WILDLDQFNEWMNEEDYEVGEGGPKRKRISAKTLTDEVTTPGDERRDKKPGSAKKRKRSP
SPSPTPPSQESKKKNTKKGPTTPYTKSKRGQREEEPEDLTKDLDEPSPVPAVEEITLPKT
ANTKKDSELTPVKGGTMTDLDEQEDESMETAEKEEEEGSPSVKGEPVKGLDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDSESRPTPMGPPPTSHFHVLADTPSS
LVPLQPKASQVHRHTQTGCFYILVLDASIXLXLHSTSLCPLXTPAAQQILSFPDKVKEKQ
PADLQNFGLRTDMYSKKTGPPKSKTAANAMRDWTEQETLLLLEGLEMYKDDWNKVSEHVG
SRTQDECILHFLRLPIEDPYLEDMSSSLGPLAYQPVPFSQAGNPVMSTVAFLASVVDPRV
ASAAAKSALEEFSRMKEEVPAALVEAHVRRVEEAARTSGRQDPLYGLEGSGIAGTSLEEG
EKPEESSEESKSDSQSSEEKRETKENKEGAMEEGEKKGENGKKEEERGREGEGEGEQEAE
KTDSEMGDGEKEKEGKEGLEEGQREGESEGERKAKVERDVGEGNLATAAASALAAAAVKA
KHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQS
FHMEQLKYAEMRARQQHFQQIQHQQHSQTGGPHPAPAPTGPPPQGPSATQSQPTLSTPAP
QPAPSPAPLTTSIPSSAQPTEPQPPPSGPHTSPPRPPGHSSTNTTPTLHESSAPGDTLHS
STAAPTPQ
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcggaagaaagacggcggcccgaacgtaaaatatttcgaaacgtctgatacc
gtctcgcaattcgacaatgtccgcgtttggttgggcaagaattataaaaagtacatccag
gcagagccccccaccaacaagtctctgtccagcctggtggtccagctactgcagtttcag
gaggaggtgttcggacgacatgtcagcaacccacctctcaccaggctgccgatgaagagt
ttcctggactttaagtctggtggggctctctgccacattctggcagcagcctacaagttc
aagagtgatcagggctggcgcaggtttgactttcagaatccttctcggatggaccgcaat
gtggagatgttcatgactatcgagaaatccctggtacagaacaactgtctgagtcgacca
gtgatctacctgagctctgacattgaggccaagctgctggggaaactgaaggacataatc
aagaggcaccagggctcagtgactgaagacaagacatgcagctcccatgtggtggttcct
atccctgccagtcttgaggaggaggagtgggtgcgtccggtgatgaagagagacaagcag
gtgctgctccactggggatattctcctgacagctatgacacctggatcttagccagtgag
gtggaggcagctgttgaagatccgcccagcccagagaaacccaggaaggtccatgccaag
tggatcctggacctggaccagtttaatgagtggatgaatgaggaggactatgaggtcgga
gaggggggccccaagaggaagagratctcagccaagaccctgacggacgaggtgaccacc
ccaggggacgagcgccgggataagaagcccggaagcgccaagaagaggaagcgctccccc
tccccctcgcccactccaccatcccaggagagcaagaagaagaacaccaagaaagggccc
accaccccgtacactaagtctaagcgaggccagagagaggaggagccggaggatctgact
aaagatctggatgaaccatcacctgtacctgctgtagaggagatcaccctacctaagaca
gccaacactaagaaagactctgagttgacaccagtgaaaggaggtaccatgacagacctg
gatgagcaagaggatgaatccatggaaactgcagaaaaggaggaggaggagggctctccg
agtgtgaaaggagagccggtgaaagggttggacctccatgaggacaacgtgactgagcag
acccaccacatcatcattcccagctacgctgcatggtttgactacaacagtgtccatgct
attgagcgcagagcccttccagagtttttcaatggcaagaacaaatccaaaacccctgag
atttacctggcctacaggaacttcatgattgacacgtacaggctgaacccgcaggagtac
ctcacctccaccgcctgtcgtaggaacctggccggagacgtgtgcgccatcatgagggtg
catgcattcctggagcagtggggtctgatcaactaccaggtggactcagagagccggccc
acccccatgggccccccgcccacctcccacttccacgtcctggctgacaccccctccagc
ctggtgcccctgcagcccaaggcctcccaggtacacagacacacacagacaggttgtttc
tatattttggttctagatgcctctatttgactgtagcttcactccacttctctctgtccc
ctctagactccggcggcccagcagattctgtccttcccagacaaggtgaaggagaagcag
ccagccgacctgcagaactttggcctgaggacagacatgtacagcaagaagactgggcct
cctaagagtaagactgctgccaatgccatgcgagactggaccgaacaggagacactactg
ctgctagagggtctggagatgtacaaggatgactggaacaaggtgtcagagcacgtgggc
tcacgtacccaggacgagtgtatcctgcacttcctgcgtctgcccatygaggacccatac
ctggaggacatgtcctcgtccctgggccccctggcctaccagcccgtccccttcagccag
gcaggcaaccccgtcatgagcaccgtggccttcctggcctccgtggtggacccccgcgtg
gcctccgcagccgccaagtctgccctggaggagttttcgcgtatgaaggaggaggtccca
gcagcactggtggaggcccatgtgaggagggtggaagaggcggcgcggaccagtggcaga
caggaccccctctacggcctggagggcagcggcatcgcaggcaccagcctggaggaggga
gaaaaacctgaagagagcagtgaggagagtaaaagtgacagccaatccagtgaggagaag
agggagaccaaggagaacaaagagggagccatggaagagggggagaagaaaggagaaaat
gggaagaaggaggaggagagagggagagagggagaaggagagggagagcaagaagctgag
aagacagactcggagatgggtgatggagagaaggagaaggaagggaaggagggcttggag
gagggccagagagaaggagagagtgagggagagaggaaggctaaggtggagcgggatgtg
ggagaggggaacctggctaccgctgctgcctctgccctggctgctgctgccgtcaaagcc
aagcacctggctgcggtggaggagaggaagatcaagtctctggtggctctgctggtggag
actcagatgaagaagctggagatcaaactgagacactttgaagagctggagactatcatg
gaccgagagagggaggctttggagtaccagaggcagcagctgctggcagaccgtcagtcg
ttccacatggagcagttgaagtatgcagagatgagggcgcgtcagcagcacttccaacag
atccagcaccagcagcatagccagactggaggcccacaccccgccccggcccccacgggc
cccccaccccagggcccctcagccacccagtcccagccaaccctcagtacccctgcacca
cagccagctcccagcccagcaccccttaccacctccatcccttcctctgcccagcccact
gagccccagccgccccccagtggtcctcacacctcacctccccgcccgccaggccactcc
agcaccaacaccaccccaacactccacgagtccagcgcccctggggatacactccactcc
tcaaccgctgctcccactccacagtga

DBGET integrated database retrieval system