KEGG   Salvelinus alpinus (Arctic char): 112069693
Entry
112069693         CDS       T05762                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04012  ErbB signaling pathway
salp04068  FoxO signaling pathway
salp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112069693
   04068 FoxO signaling pathway
    112069693
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112069693
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 112069693
NCBI-ProteinID: XP_023992828
LinkDB
Position
Unknown
AA seq 188 aa
MCNNMSNVSLSNGSPTLERVDPRPTDHMKPQICRNLFGSVDHDEFGRECLVZMKEMEKVF
IDKWNFDFLNDEPLPQGDYKWEPMKSSDVPDFYSRPPHKRVWSSGNVDHNGNHDNGVRRS
CPANGAELSEKNERQTDCHHSHNGARKRPANPEPQSTGKKLHSSEEDEVVSKSVEQTPSK
NDSRTHEH
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtgtaacaacatgtcaaatgttagtctttcgaatgggagtccgacgttggaaagggtg
gatccgcgaccgacggatcacatgaagccccagatttgcagaaatcttttcggatcggtg
gatcatgacgaatttgggagggagtgtttggttsaaatgaaagagatggagaaggttttt
attgacaaatggaattttgattttctaaacgacgagccccttccccagggagattataaa
tgggaaccgatgaaaagcagtgacgtgccagacttttacagcagaccgcctcataagcga
gtctggtcctctggaaatgtggaccataacgggaatcatgataacggagtccgacggagc
tgtcctgcgaacggggctgagctatccgagaagaacgagagacagacggattgtcaccac
tctcacaacggggcaaggaaaagacctgcaaatccagaaccccaaagtacaggtaaaaag
ttgcattccagtgaagaggatgaagttgtgtcaaagtcagtagagcagacacccagcaaa
aacgattccaggacacatgaacactaa

DBGET integrated database retrieval system