KEGG   Salvelinus alpinus (Arctic char): 112069820
Entry
112069820         CDS       T05762                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112069820
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112069820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    112069820
   00536 Glycosaminoglycan binding proteins [BR:salp00536]
    112069820
Cytokines and growth factors [BR:salp04052]
 Growth factors
  Growth factors (RTK binding)
   112069820
Glycosaminoglycan binding proteins [BR:salp00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   112069820
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 112069820
NCBI-ProteinID: XP_023992964
LinkDB
Position
Unknown
AA seq 128 aa
MDSEVICSRIIQLTRLYCMNGGHDLQILPDGTVGVWTMVLVVIQGTEAGCYLALSQNCKS
YQSSIVTDPFYFLEKMEVNHYNTYQAQMYKERSWYVGLKKNGKHKLDSRTHIGQKAIFLP
RRLEGTGE
NT seq 387 nt   +upstreamnt  +downstreamnt
atggattcggaagtaatctgctcgagaataatacaactgacccgcctatactgcatgaat
ggcggacatgatctgcagattctcccggatgggacggtgggagtgtggaccatggtgttg
gttgtcatccaggggacagaggcaggatgctacttggcccttagccaaaactgtaaatct
taccaatcttcgatagtaactgatccgttttatttcctggagaagatggaggtgaaccac
tacaacacgtaccaggcccagatgtacaaggagaggagctggtacgtgggactgaagaag
aacgggaaacacaaactagactccagaacccacatagggcagaaggccattttcttgcca
cggcgactagagggcacaggggagtga

DBGET integrated database retrieval system