KEGG   Salvelinus alpinus (Arctic char): 112070233
Entry
112070233         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112070233
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    112070233
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:salp03310]
    112070233
Transcription factors [BR:salp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    112070233
Nuclear receptors [BR:salp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   112070233
SSDB
Motif
Pfam: Hormone_recep GCR zf-C4
Other DBs
NCBI-GeneID: 112070233
NCBI-ProteinID: XP_023993427
LinkDB
Position
Unknown
AA seq 663 aa
MDSLIGDSDPNLFPMSMKTETAFSRDQDLMDMDQEGYIGKDQKLFSDNTLDLLQDFELTG
SPSDFYVGDEAFLSSLADDALLGDESQDRGVSNSTSKPAATMTNSGGFSGSNTTTLNGSS
LLACQDESNSSTSTTTTGTFPMVKEAGFIQLCTPGVIKQEKTSAMRSYSCQMSGSTGGST
SSSPSELSSASPSPIPISICGVSTSGGQSYHFGGNSSINTPLASTTSGASQQKDQKPSVF
SLYPPLVTVGEAWNNISYGDGASGMQGLSSPTSSFSSNYASSTSRQGGGAASCTTQGKAG
TTHKICLVCSDEASGCHYGVLTAEAAKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPA
CRFRKCLMAGMNLEARKTKKLNRLKGVQQPTMAELTPRPLPEARSLVPKSMPQLTPTMLS
LLKAIEPDTIYSGYDGTLPDTSTRIMTTLNRLGGRQVVSAVKWAKALPGFRDLHLDDQMT
LLQCSWLFLMSFGLGWRSYQQCDGNMLCFAPDLVINQDRMKLPYMADQCEQMLKISSEFV
RLQVSHDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQR
FYQLTKLLDSMHEMVGGLLDFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLF
HQK
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggactccctgatcggggactcagaccccaacctgttccccatgtccatgaagacggag
acagccttctcccgggaccaggaccttatggatatggatcaggaagggtacattggaaaa
gaccagaaactgttcagtgacaacactctggatctcctccaggactttgagttgacaggc
tccccttcagacttttacgtaggggacgaagccttcctctcctccctggctgatgacgct
ctcctgggggatgaaagccaggatcgtggcgtctccaactccacctccaagccagctgct
actatgaccaatagtggtggttttagcggttccaacaccaccacattgaatggtagcagt
ctactagcatgtcaggatgaatccaactccagcacctctacgacgaccaccggcactttt
cccatggtgaaggaagctggcttcatccagctgtgtactccaggggtgatcaaacaggag
aagacgtcggccatgcgtagctactcctgccagatgagtggtagtaccggcggctccact
tcctcctctccctccgagctgtccagcgccagccccagccccatccccatctccatctgt
ggggtgagcacctctggaggacagagctaccactttggaggcaacagcagcatcaacacc
cccttggcttccactaccagtggagcttctcagcagaaggaccagaagccctctgtgttc
agcctgtatcctccgctggtgacagtaggagaggcctggaacaacattagctatggggat
ggagcttctggaatgcaaggtctctccagccctacctcctctttctccagcaactatgcc
agttctacctccaggcagggtggtggcgctgcgtcgtgtacaacccagggcaaggccggg
accacccataagatctgtctggtgtgttcagatgaggcgtctggctgtcactacggggtg
ctcactgcggaagctgccaaggtgttcttcaagagagccgtggaagggcaacacaactac
ctgtgtgctgggaggaacgactgcatcatcgataagatcagaaggaagaactgtccagcc
tgccgcttccgcaagtgtctcatggcagggatgaacctggaagctcgtaaaaccaagaag
ctgaaccgtttaaagggggtgcagcagcccaccatggccgagctgaccccccgtcctctc
ccagaggccaggtcgctggtccccaagtccatgccacagctcacccccaccatgctgtct
ctactaaaggccatcgagccagacaccatctactctggctacgacggcaccctgccagac
acctccacacgcatcatgaccaccctcaacaggctggggggacgacaggtggtatcagcc
gtcaagtgggccaaggccctgccagggttccgggaccttcacctggacgaccagatgact
ctgctgcagtgttcctggttgttcctcatgtccttcggcctgggctggaggtcctaccaa
cagtgtgacgggaacatgctctgcttcgctccagacctcgtcatcaaccaggaccgtatg
aagctgccctacatggcagaccagtgtgaacagatgttgaagatctccagtgagttcgtc
agactgcaggtgtctcatgacgagtatctgtgtatgaaggtgctgctgctgctgagcacc
gtgccaaaggatggtctgaagagtcaggcagtgtttgatgagatcaggatgtcctacatc
aaggagttggggaaggccatcgtcaagagggaggaaaactccagccagaactggcaacgc
ttctaccagctcaccaagcttcttgactccatgcacgagatggttggtgggctgctggac
ttctgcttctacacgttcgtcaacaagtctctgtcggtggagttcccagagatgttagca
gagatcatcagcaaccagttaccaaaattcaaagccgggagcgtcaaacccctcctcttc
caccagaaatga

DBGET integrated database retrieval system