KEGG   Salvelinus alpinus (Arctic char): 112072786
Entry
112072786         CDS       T05762                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112072786
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    112072786
Cytokines and growth factors [BR:salp04052]
 Cytokines
  CSF and other factors
   112072786
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 112072786
NCBI-ProteinID: XP_023995939
LinkDB
Position
Unknown
AA seq 186 aa
MFHNSSRGLFAFLLMLLEWTKPGLSNPLRPICDPRVLKHFIEEARDAEAAMLACKEGSGL
AEPVTVPQTKVDFNVWERKNALEQAQEVQSGLWLLNQAIGSLRTSVANTALHSHIDNSLR
NIFSIGQVLRSLNIQEYTPPAGGVAGGGETWRVSSAAELLQVHVNFLRGKVHLLLSNAPI
CHQGSS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgttccacaattcaagtagaggactctttgcctttctgctgatgctgttggagtggacc
aaaccagggctatctaaccccctgcgtccgatctgtgacccgcgggtcctaaaacacttc
attgaagaggccagagatgctgaggcagccatgctggcatgtaaagaaggatctggtctt
gcagagcccgtcactgttccccaaaccaaagtagacttcaacgtctgggagaggaaaaat
gcactggagcaagctcaggaggttcagtctggcctgtggctgttaaaccaggccatcggc
tcgctacgaacctccgtcgccaacacagcgctgcacagccacatagacaacagcctcaga
aacatcttcagcatcggacaggtgctgcgcagcctcaacatccaggagtacacccctcca
gcagggggagtggctggaggtggggagacatggcgggtgtcgtctgctgcagagctcctc
caggtccacgttaacttcctgcgaggcaaggtgcacctcttgctgtccaacgcacccatc
tgccaccagggtagcagctga

DBGET integrated database retrieval system