KEGG   Salvelinus alpinus (Arctic char): 112072968
Entry
112072968         CDS       T05762                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04210  Apoptosis
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04622  RIG-I-like receptor signaling pathway
salp04623  Cytosolic DNA-sensing pathway
salp04625  C-type lectin receptor signaling pathway
salp04920  Adipocytokine signaling pathway
salp05132  Salmonella infection
salp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112072968
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112072968
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112072968
   04621 NOD-like receptor signaling pathway
    112072968
   04622 RIG-I-like receptor signaling pathway
    112072968
   04623 Cytosolic DNA-sensing pathway
    112072968
   04625 C-type lectin receptor signaling pathway
    112072968
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112072968
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112072968
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112072968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112072968
Protein kinases [BR:salp01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112072968
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 112072968
NCBI-ProteinID: XP_023996105
LinkDB
Position
Unknown
AA seq 601 aa
MVQPQNDTWDMAGDEGGGALRVPPELAANEVVTRLLGDNQQLREALQRSNQALRERCEEM
EEWQRRSREEREFLSCRFQEARALVKRLTRENHSLTSLASPSSPSNPEASQGLLVNGPSV
SQDSCPNSTNCSSNGGPGRGGEQEKSSETNGTMATSLVTERGMEKKGAEENEQMMLHSLP
SEGGNRFLQLLKSHKEKLEEGMRDLRLRNEELEKEGEEGKRERDCLRRSVEQLESKLVQA
QSCGVTEETVQHSDASPPSDSSHLAKLTEQLQATQCRYRELQEKLDSLQKTSAQRDRTEV
LLKQKDKDCAQLAKDGEALKAQVTSLLGELRERQSCLDQSQQDRNILDDKLSSTREALAV
SEREMEQQRKQHSVTVDKLLLQTHNLETALKTDRMVITEERRKLAQLQHAYTCLFKDYDS
KLKTEGGDMVVRLEEAERALALKQDLIDKLKEEVEQQRGSLETVPVLTAQAEIYKADFLA
EREAREKLNQRKEELQDQLNTVLAEMERLKQEGTSRARMEEMQQRHLEDFIPRPNIPPQP
GVAFNTAPPPSSFRSVGLAAGVAGGVSGGGAEELPDYRCPKCQYQAPDMDTLQIHVMDCI
Q
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggtacagccccagaacgacacctgggacatggcaggggacgagggaggcggggctctc
cgggttccacccgagctggcagccaatgaggtggtgaccagactactgggagacaaccag
cagctccgagaggcgttgcagcgcagcaaccaggccctgcgtgagcgctgtgaggagatg
gaggaatggcagcggaggtctagagaagagagggagttcctcagctgtcgtttccaagag
gcccgggcgctagtgaagagactgaccagggagaaccacagccttaccagcctggccagc
ccctcgagcccctccaaccctgaagctagccaaggcctgctggtcaacggccccagtgtc
agccaggactcctgccccaactctaccaactgcagctccaatgggggtcctgggagagga
ggggagcaggagaagagctcagagaccaacggaaccatggcaacctcactggtgacagag
agagggatggagaagaagggagcagaggagaatgagcagatgatgctccacagcttgccc
tcagaaggagggaacaggtttctccagttgctgaagagccacaaagagaagttggaagaa
gggatgagagatctgaggttgaggaatgaagagctggagaaagagggggaggagggaaag
cgggagagagactgtcttcgtcgctcagttgagcaactcgaatccaagctggttcaggca
cagagctgtggtgttaccgaggaaacggttcagcattccgatgcatcgcccccatctgac
agctcccacctggccaaactcacagagcagctgcaagccacacagtgcaggtacagagag
ctgcaggagaagttagattccctccagaagacttcagctcagagagacagaactgaagta
ctgcttaaacagaaggacaaggactgtgcccagctggctaaggacggcgaggcgctgaag
gcccaggtgacgtctcttctgggtgagctgagagagagacagagctgtctggaccagagc
cagcaggaccgcaacatactggacgacaagctgagcagtactcgggaggcgttggcagta
tcagagagagagatggaacaacagaggaagcagcactctgtgacggtagacaaactactg
ctgcagacacacaacctagagaccgccctgaagactgaccgcatggttattactgaagag
aggaggaagctagcccagctgcagcacgcctacacctgtctgtttaaggactacgactcc
aaactaaagactgagggaggagacatggttgtccgtctggaggaggcagagagagcgttg
gctctgaaacaggacctgattgacaagctgaaggaagaggtggagcaacagagaggatct
ctagagaccgtccctgttctcaccgcccaggctgagatctacaaggcggacttcctcgcg
gagcgggaggccagagagaagttgaaccagaggaaggaggagcttcaggaccagctgaac
acagtgctggctgagatggagcgtctgaaacaggaggggacctcacgggctcgtatggag
gagatgcagcagagacacctggaggatttcataccacgacccaacatccccccacaacca
ggggttgcttttaacacggcccctcccccttcctccttccgcagcgtgggattggctgca
ggagtggcagggggtgtctctggaggcggggctgaagagcttcctgactaccgctgtcca
aagtgccagtaccaagcccccgacatggacacactgcagatacatgtcatggactgtatc
cagtaa

DBGET integrated database retrieval system