KEGG   Salvelinus alpinus (Arctic char): 112073798Help
Entry
112073798         CDS       T05762                                 

Definition
(RefSeq) matrix metalloproteinase-9-like
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:salp01002]
    112073798
Enzymes [BR:salp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     112073798
Peptidases and inhibitors [BR:salp01002]
 Metallo peptidases
  Family M10
   112073798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Peptidase_M66 Reprolysin_3 Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 112073798
NCBI-ProteinID: XP_023996802
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
MRSHHRVLVFLVLALCTVGGWCVPLKKSVSVTFPGDVLKNMTDLELAESYLKRFGYMNVQ
HRSGFQSLVSNSKALTRMQRQMGLEETGTLDKSTVAAMKAPRCGVPDVRSYQTFDGDLKW
DHHDVTYRILNYSPDMGASLIDDAFARAFKVWSEVTPLTFTRLFDGTABIMVSFGKADHG
DGYPFDGKDGLLAHAFPPGEGIQGDAHFDDDENWTLGKGAAVKTSFGNAEGALCHFPFSF
EGKEYSTCTTEGRSDNLPWCATTADYGRDKKFGFCPSELLYTFDGNSNGKECVFPFVFLG
ETYEGCTTEGRSDGYRWCSTTDNFDKDKKYGFCPNRDTAVIGGNSEGEPCQFPFVFLGKK
YDACTSEGRGDGRLWCATTGDFDADTKWGFCPDRGYSLFLVAAHEFGHALGLDHSNIRDA
LMYPMYSYVEDFSLHEDDVEGIQYLYGSKTGPDPTPPGPTIPTPGPSDEPEPNTPTTTTT
SPTTTHPVDPSQDPCQINKFDTITEIDGDLHFFKDGQYWRLSSKTDGGLKGPFSMSERWP
ALPAVIDTAFEDLVTKKIYFFSGTRFWVYTGQSLLGPRSIDKLGLPSTVEKVEGALQRGK
GKVLLFSGENYWRLDVKGQNIDKGYPRFTDIVFGGVPNDAHDVFHFKGHIYFCRDRFYWR
MNSRRQVDRVGYVKYDILKCTDSSNYRY
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagatctcaccatagagttctggttttcctagtgttggcattgtgcactgtaggtgga
tggtgcgttcccctgaagaaaagcgtgtctgtcaccttccctggagatgtccttaagaac
atgacggatttggagctggcagaaagctacctgaagaggtttggctacatgaacgttcag
caccgcagtggtttccagtccttggtgtccaactccaaggctctgacgagaatgcagagg
cagatggggttggaggagacagggacgctggacaagtctacggtagcagccatgaaggca
cctcgctgtggggtacccgacgtacgctcctaccagacctttgacggggacctaaaatgg
gatcatcatgatgttacatacaggatcctgaactactctccagacatgggagcctctctg
atagacgatgccttcgccagagccttcaaggtgtggagtgaggtcacccctctcaccttc
acgcgactgttcgacggcaccgccracatcatggtgtcctttggaaaagcagatcatgga
gacggctaccccttcgatggtaaggacggccttctggcccacgccttcccccctggtgag
ggcatacagggagacgcccacttcgacgatgatgaaaactggaccctcggcaaaggagca
gctgtgaagactagctttggcaacgcagagggtgctctgtgccacttccctttctccttc
gagggcaaggagtactccacctgcaccacagaggggcgctctgacaacctgccctggtgt
gccaccacagccgactacggcagagacaagaaattcggcttctgtccaagtgaacttctg
tacacattcgacggaaacagcaacggcaaagaatgtgtgttccccttcgtgttcctgggg
gagacatatgaaggttgcaccacggagggtcgcagtgatggataccgctggtgttccacc
acagacaactttgacaaggataagaaatatggcttctgtcccaacagagatacggctgtg
attggtggaaactctgagggagagccgtgccagttcccctttgtcttcctggggaagaag
tatgacgcatgcaccagcgagggacggggagacggcaggctgtggtgcgctaccaccggc
gactttgacgcagacacgaaatggggcttctgcccagataggggctacagtctgttcctg
gttgcggcccacgagtttggtcatgccctgggtctggaccactccaacatcagagacgcc
ctcatgtatcccatgtacagctacgttgaagacttctccctgcatgaagatgatgttgag
ggcattcagtatctctatggatccaagacaggccctgaccccacaccccctgggcccacc
atccctacacctggtcccagcgatgagcctgagcccaacaccccgactaccaccactacc
agccccaccactacacaccctgtggacccatcccaggacccctgtcagatcaacaagttc
gacaccatcacagagatcgatggagacctgcacttcttcaaggatgggcaatattggagg
ctgtcaagcaagacagacggtggactgaagggtccgttctccatgtctgagaggtggcca
gctctgccagccgtcattgacacggcctttgaggaccttgtgacaaagaaaatctacttc
ttctcaggcaccaggttctgggtgtatacaggacagagtctcctgggaccccgcagcatt
gacaaactgggtctgccctctactgtagagaaggtggagggagcactgcagagagggaaa
ggcaaggtgctgctcttcagtggagagaactactggaggctggatgtgaagggccagaat
atcgacaagggatatccccgcttcacagacattgtcttcgggggtgttcccaatgacgct
catgatgtcttccacttcaagggccacatctacttctgtcgggatcgtttctactggcga
atgaactctaggagacaggtagaccgtgtgggatacgtgaagtacgatatcctgaagtgc
accgactcctccaactaccgctactga

DBGET integrated database retrieval system