KEGG   Salvelinus alpinus (Arctic char): 112074291Help
Entry
112074291         CDS       T05762                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00010  Glycolysis / Gluconeogenesis
salp00053  Ascorbate and aldarate metabolism
salp00071  Fatty acid degradation
salp00280  Valine, leucine and isoleucine degradation
salp00310  Lysine degradation
salp00330  Arginine and proline metabolism
salp00340  Histidine metabolism
salp00380  Tryptophan metabolism
salp00410  beta-Alanine metabolism
salp00561  Glycerolipid metabolism
salp00620  Pyruvate metabolism
salp01100  Metabolic pathways
Module
salp_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112074291
   00053 Ascorbate and aldarate metabolism
    112074291
   00620 Pyruvate metabolism
    112074291
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112074291
   00561 Glycerolipid metabolism
    112074291
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112074291
   00310 Lysine degradation
    112074291
   00330 Arginine and proline metabolism
    112074291
   00340 Histidine metabolism
    112074291
   00380 Tryptophan metabolism
    112074291
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112074291
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112074291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 112074291
NCBI-ProteinID: XP_023997253
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRIVLSRTLPRISGISNCQYSAAAIPVPSAQPEVHYNKLFINNEWQDAVSKRSFPTINP
ATGEVICQVAEADKADVDKAVKAAREAFRFGSPWRRMDASDRGLLLSRLADAIERDTAYL
AELETLDNGKPYAVSYSVDVPMVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNILP
GMGPSAGSAIASHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIIMSDAN
MAEAVEQSHFALFFNQGQCCCAGSRTYVQDTIYDEFMERSVERAKSRVVGDPFNMKTEQG
PQVDEEQFKKILGYISSGKREGAKLMCGGGVAADRGYFIQPTIFGDVQDGMTIAREEIFG
PVMQILKFKTLEEVVERANDTKYGLAAAVFTKDIDKAHYISSGLRAGTVWINCYDVFGAQ
APFGGYKYSGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaattgtgttatccagaactttgcctcgaatctctggcatttcgaattgtcag
tattctgcggccgccatcccggtaccaagcgcacagcccgaagtccattacaacaagctg
ttcatcaataacgagtggcaggatgccgtcagcaagaggtccttccccaccatcaaccca
gccacaggagaggtcatctgtcaggtggctgaggcagacaaggcagatgtggacaaggct
gtgaaggctgccagggaggccttcaggtttgggtcaccatggcgacgcatggacgcgtcg
gaccgcgggctgctcctgagccgactggcagacgcaatcgagagggacacagcctaccta
gcggaactggagaccctggacaatgggaagccctatgccgtgtcctacagcgtggacgtg
cccatggtggtcaagtgcctcaggtactatgcaggctgggcagataagtgggaggggaag
accattcccattgatggagacttcttctgctacactcgccatgagcccatcggtgtgtgt
ggccagatcatcccgtggaacttccctctgctgatgcaggcatggaagctggggccagct
ctggctacaggcaacactgtggtgatgaaggtggctgagcagacccccctcactgccctg
tatgtggccagtctcatcaaggaggttggtttccctccaggtgtggtgaacatcctgcct
ggtatgggtccatctgctggttctgccatcgcctcccacatggatgtggataaggtggct
ttcacaggatctactgaggtaggtcacctgatccagcaggcatctggctccagcaacctg
aagaaggtcactctggagctgggaggaaagagccccaacataatcatgtctgatgccaac
atggcggaggcggtggaacagtcccactttgccctgttctttaaccagggccagtgctgc
tgtgccggctcccgtacatatgtgcaggacaccatctatgatgagtttatggagcgcagt
gtggagcgggccaagagcagggtggtgggagaccccttcaacatgaagactgagcaggga
ccgcaggtggatgaggaacagttcaagaagattctgggctacatcagcagtgggaagcgt
gagggggccaagctgatgtgcgggggaggggtggctgcagaccgtggctacttcatccaa
ccaaccatttttggagatgtccaggacggcatgaccatygcccgtgaggagatctttggg
ccggtgatgcagatcctgaagtttaagactctggaggaggtggttgagagagccaacgac
acaaagtacggcctggcagctgctgtcttcaccaaagacatcgacaaggcccactacatc
tctagcggacttcgcgccggcactgtctggattaattgctatgatgtgtttggagcacaa
gcccccttcggtggctacaaatattctggtaacggtcgtgagctgggagaatatggcctg
gacaactacactgaagtgaaaacggtaacaatcaaggtccctcagaaaaactcataa

DBGET integrated database retrieval system