KEGG   Salvelinus alpinus (Arctic char): 112076337Help
Entry
112076337         CDS       T05762                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112076337
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     112076337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 112076337
NCBI-ProteinID: XP_023998922
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVLKAVCVLKGTGEVTGTVYFEQEGDNAPVKLTGEILGLTPGEHGFHVHAFGDNTNGCVS
AGPHFNPHSKTHGGPNDDVRHVGDLGNVTAGADSVAKINIQDKILTLTGPYSIIGRTMVI
HEKADDLGKGGNEESLKTGNAGGRQACGVIGITQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaggctgtttgcgtgctgaaaggaaccggtgaagttaccgggaccgtatac
tttgagcaggagggtgacaacgctccagtgaagctgaccggggagatcttgggtctaacc
ccgggggaacatggcttccacgtccacgccttcggagacaacaccaacggctgtgtgagt
gcaggaccccacttcaacccccacagcaagacccacggaggacccaacgatgatgtcagg
cacgtaggggaccttggcaacgtgactgcaggagccgacagtgtggctaagatcaacatc
caggacaagatactgactctcactggaccctactccatcatcggcaggaccatggtgatc
catgagaaagccgatgacctggggaaaggaggcaacgaggagagtctgaagacgggcaac
gctggcggtcgccaggcctgtggtgttattggaattacccagtaa

DBGET integrated database retrieval system