KEGG   Salvelinus alpinus (Arctic char): 112078270Help
Entry
112078270         CDS       T05762                                 

Gene name
mapk6
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112078270 (mapk6)
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112078270 (mapk6)
Protein kinases [BR:salp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112078270 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 112078270
NCBI-ProteinID: XP_024000329
LinkDB All DBs
Position
Unknown
AA seq 834 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNTVKVFETLGPSGRHLTDNILYFPLPVNSVYIVQEYMETDLCQLL
ERGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMD
PHYSHKGHLSXGXVTKWYPVSSPAVSPNNYTRPLTCGAAGCIFAEMLTGKTLFAGAHXAW
SRLQLILESIPVLREEDXAELHSVIPLHTRXHVPPHNPLAKLLPDVSPQAWHFLQKILTF
NPMDRLTAKEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDRVTSHTWDRYAETY
SSFSEGDWHLHTHSTLDTDETGGPRALSDQTDERGVQVDPRKYADGDREFLDDPSYGYSS
LFTPERSWPDPDDEHLDLHHENKYCDLECSHTCNYKVASPSYLDNLIWRDSEVNHYYEPK
LIIDLSNWKEQQSREKQAQAAGRDKEHKAQKSKCEKNGLVKAQMVLQVEKGPVEKDSQQE
KNQTQTTQQNQGFDFDSFIAGTIKLSLRTEPSDVGLLGDVGLLSEVEVGLLSEVGLLSEV
GLLSEVGLLSEVXLLNELNSSVSQLEAPRSGSMSKTISQEKEEKCLVNFAQVSITVGTAG
SGARPAHPWESFGGGERVEERRGGCLMDGAGRWDXGKEEQLQKDSSYTSYLDRLFSRKDE
GSGESAAGADTPEPEPSDVGGERERDEGGFLARSGEIMFNMQLDSLALPGFDATTDVPLK
SIQASLAPSTVKSIQASLAPSTVKSIQASLAPSTVKCSPQIAHTTYSSFFKHLN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagtttgagtctctgatgaacatccaygggtttgacctgggcccacgttac
atggacctgaagcctctgggctacggmggsaacggcctggtgttctcagccgttgacacg
gactgcgacaaacgcgtggcggtgaagaagatcatcctgacggatcctcagagcgtcaaa
cacgccctgagagagatcaagatcatcaggaggctggaccacgacaacaccgtcaaggta
tttgagacgctagggcccagcggtcgtcacctaacagataatattctctacttccctctc
ccagtgaactctgtgtacatcgtccaggagtacatggagacagacctgtgtcagctcctg
gagaggggtcttctctctgaggaccacgccagactcttcatgtaccagctgctgagaggc
ctcaagtacatccactctgccaacgtactgcacagagacctgaagcctgccaacttgttc
gtcaacacagaggacctggtgctgaagataggagactttgggctggctcggatcatggat
cctcactactcacacaagggtcatctttcttgagggntggtgactaaatggtacccggtc
tcctcgcctgctgtctcccctaacaactacaccaggccattgacatgtggggctgccgga
tgcatcttcgccgagatgctcaccgggaaaacgctcttcgcaggagcacattgagcttgg
agcagattgcagctcatcctggagtccatccctgtgctgagagaagaggacnnggcagag
ttacacagtgttatcccccttcatacacggtgacatgtcccaccacacaacccactggcc
aagctactgcctgacgtcagcccacaggcctggcatttcctgcaaaagatcctgaccttt
aaccccatggaccgtctgacagcgaaggaagccctagcccacccctacatgtctgactac
tccttccccctggacgaacccgtctccctgcaccccttccacatagaggatgaggtggat
gatatcttactgatggacagggtcacaagccacacctgggacaggtacgcggagacatac
tccagcttttctgaaggggactggcacctccacacccacagcactctggacactgacgag
acaggtggacctcgggctctgtctgaccaaactgacgagagaggagtccaggtggaccct
cgtaagtatgcagacggagaccgggagttcctggacgatccttcctacggctactcctcc
ctcttcactcccgaacgctcgtggcccgaccccgatgacgaacacttggaccttcaccac
gagaacaagtactgtgacctggagtgttcccacacctgtaactacaaggtggcgtctcca
tcctacctggataatctgatctggagggacagcgaggtcaaccactactacgagcccaaa
ctcattatagatctgtccaactggaaggagcagcagagtagagagaaacaggcccaggct
gcaggcagagacaaggagcacaaggcccagaagagcaagtgtgagaagaacggcctggtg
aaggctcaaatggttctacaggtagagaagggccccgtggagaaggactcccagcaagag
aagaaccagacccagactactcaacagaatcaaggctttgactttgactccttcatcgcc
ggcaccatcaaactgagcctgcgaactgagcccagcgacgttggactcctgggggacgtg
ggactcctgagcgaggtggaagtgggcctcctgagcgaggtgggcctcctgagcgaggtg
ggcctcctgagcgaggtgggcctcctgagcgaggtgmgcctcctgaacgagctcaactcg
tctgtgtcccagctggaggctccgcggtcaggctccatgtccaaaaccatcagccaggag
aaggaggagaagtgtctggtcaactttgctcaggtcagcatcaccgtggggaccgctggg
tctggggcgcgtcccgcacacccctgggagagcttcggagggggggagagggtggaggag
cggagaggtgggtgtctgatggacggggcggggcgctgggacyttgggaaagaggagcag
ctccagaaggacagctcctacaccagctacctggacagactgttcagcaggaaggacgag
ggcagcggggagagtgctgctggcgccgacaccccagaacccgagccctcggatgtggga
ggggagagggaacgggacgaggggggcttcctggcgcggagcggagaaatcatgtttaac
atgcagctggactctctggcgctgccggggttcgatgctacgactgacgtgccgctcaaa
tccatccaggcctccctcgctccctccacggtcaaatccatccaggcctccctcgctccc
tccacggtcaagtccatccaggcctccctcgctccctccacggtcaagtgctctcctcag
atcgcccacacaacctacagcagcttcttcaagcatctgaattag

DBGET integrated database retrieval system