KEGG   Salvelinus alpinus (Arctic char): 112079261Help
Entry
112079261         CDS       T05762                                 

Gene name
apip
Definition
(RefSeq) LOW QUALITY PROTEIN: methylthioribulose-1-phosphate dehydratase
  KO
K08964  methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00270  Cysteine and methionine metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    112079261 (apip)
Enzymes [BR:salp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     112079261 (apip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II Sigma70_r4_2 HTH_23 HTH_Tnp_ISL3 Adeno_E4 HTH_29
Motif
Other DBs
NCBI-GeneID: 112079261
NCBI-ProteinID: XP_024001026
LinkDB All DBs
Position
Unknown
AA seq 328 aa AA seqDB search
MVKGKELSEDVRNLIITKHGLKQGYKSISRDLGIAVSTVRNVIRKHAVHGVVINLPGRGR
KKNLVPPVEXADRSASIQNKMTSVCDATNEDKENGSESTECQDKEHPRVLIPELCRLFYQ
LGWVTGTGGGLSLRRGDQIYIAPSGVQKERLQPDEHVCLMWKRDISSPPPLKKLRRAIVS
SLFINAFTMRAAQAVIHTHSKAAVMQLCCILQEFRITHQEMKGIRKGTSSTNYRYDEMLX
VPIIENTPEEXDLKERMALAMEQYPDSCAVLVRRHGVYVWGESWEKAKTMCECYDYLFDI
AVQMKQSGMDPSAPPIEENHYYDVQQSQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggggaaagaactctctgaggatgtaaggaatttgattataaccaaacatgga
cttaagcaaggttacaagtccatctcccgagaccttgggattgctgtttccacagttcgt
aatgttatcaggaagcatgctgtccatggagttgtaatcaacctcccaggacgtggtcgt
aagaagaatctggttccaccggttgaaaakgcagatcgttctgcatctatccaaaataaa
atgacatctgtttgtgatgccaccaatgaagacaaggagaatggttcagagtcgacggag
tgtcaggacaaggaacatccacgggttctcatcccagagttgtgtcgtcttttctaccaa
ctcggctgggttactgggacaggaggagggctaagtttgagacgtggagatcagatctat
atcgccccatctggagtccagaaggagagactacagccagatgaacatgtttgtctgatg
tggaagagagacatcagctccccaccccccttgaagaagctgagaagagccattgtgagc
tctctgttcataaatgccttcactatgagagcggcgcaggccgtcatccacacccactcc
aaggctgccgtcatgcaactctgttgtatcctgcaagagttccgcataactcaccaggag
atgaaaggaattcgcaagggcacctccagcaccaactacagatatgatgaaatgctgnnt
gtccccatcattgagaacaccccggaggagnncgacctgaaggagcgcatggcgctggcc
atggagcaatacccagactcctgtgcggtcctcgtccggcgtcacggcgtctacgtgtgg
ggggagtcctgggagaaagcaaagaccatgtgtgaatgttatgactacctatttgacatc
gccgtccaaatgaagcagagcggaatggacccttcagcaccacccattgaagagaaccat
tactacgatgtccaacaatcccaataa

DBGET integrated database retrieval system