KEGG   Streptomyces albus DSM 41398: SLNWT_0427Help
Entry
SLNWT_0427        CDS       T03823                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sals  Streptomyces albus DSM 41398
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SLNWT_0427
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SLNWT_0427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sals02042]
    SLNWT_0427
Enzymes [BR:sals01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SLNWT_0427
Bacterial toxins [BR:sals02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SLNWT_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 Laminin_G_2 DUF4185 Laminin_G_1 Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AJE80803
UniProt: A0A0B5EFK9
LinkDB All DBs
Position
570460..572403
Genome map
AA seq 647 aa AA seqDB search
MPSPRRAHLTTAAHRFLRLLVAGASAAAVVCLPGTAAAAPGAAAAKAAGLEQQVLFKASQ
DPGYACYRIPAVVRTNKGTLLAFAEARTHDCSDAGDIDLVVKRSEDGGRTWSALSVVDEG
AGDSHGNPAPVVDRRTGRILLAQTWNTGKPGGGNCDVPCDRTPHLQHSDDDGRTWSTPRD
LSSEILPKEWNSWYATGPVHGIQLTRGAHTGRLVIGVNAESWDGSRVTANHAALIISDDG
GEHWRVGAKDSYPIAADGTFRQKPSELTVEERRDGAVYVSGREQDGTDLGHRTHTVSRDG
GESFTRPFQSMPDLYIPQVQASCLRMGERMLLAAPADPDRRRTMMIRSSWDDGKTWDTVD
RGSVVTTDWSGYSDMVALGRDAVGLLYEGGAVDARDEIRFARFGLDWLGDRRGPGPSTED
RAPGAGRATVLGSPASTGGRYGKALRFDGRDDAVRLPYRDELPLGGRDFTSSLWFRYTAT
TGEQPMLWMGGIGTTQPQVWLRGEPASNRITGLITTRQGATPPTTASVRTTGAYNDGRWH
HLALRRGGGRLSLFLDGTPVTAADVPGSVTRTSPFGVHVGQRLDSRAFFDGDLDEVRVYA
RALSDTEIRGLGGKGAAVTGSPLLRLPLDRVGERPARGAGQPRGGEG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcacctcgcagggcacacctcaccaccgcggctcatcgcttcttacgtctgctg
gtcgccggggcctcggccgccgccgtcgtctgcctgcccggtacggccgcggccgccccc
ggcgccgccgctgcgaaggcggcgggactcgaacagcaggtcctcttcaaggcttcccag
gatcctgggtacgcctgctaccggatcccggcggtggtccggacgaacaagggcaccctg
ctggccttcgcggaggcccgcacccacgactgctcggacgccggggacatcgacctcgtg
gtgaaacgctccgaggacggcggccgcacctggagcgcgctctcggtggtcgacgagggc
gccggcgacagccacggcaaccccgcccccgtggtcgaccggcgcaccggccgcatcctg
ctcgcccagacctggaacaccggcaagcccggcggcggcaactgcgacgtgccctgcgac
cgcacgccgcacctgcagcacagcgacgacgacggccggacctggtccacgccccgcgac
ctcagcagcgagatcctgccgaaggagtggaactcctggtacgccaccggtccggtgcac
ggcatccagctcacccggggcgcgcacaccggacgcctggtcatcggggtcaacgccgag
tcctgggacggcagccgggtcaccgccaaccacgccgcgctcatcatcagcgacgacgga
ggcgagcactggcgggtgggcgccaaggacagctatccgatcgcggcggacggcaccttc
cggcagaagccctcggagctcaccgtcgaggagagacgcgacggcgccgtctacgtgagc
ggccgggagcaggacggcaccgacctcggccaccgcacccacaccgtcagccgggacggc
ggcgagagcttcacccggcccttccagtcgatgcccgacctctacatcccgcaggtccag
gcctcctgcctgcggatgggcgagcggatgctgctcgcggccccggccgacccggaccgg
cggcgcaccatgatgatccgcagctcctgggacgacgggaagacctgggacaccgtggac
cggggcagcgtggtcaccaccgactggtcggggtactccgacatggtggcgctcggccgg
gacgcggtgggcctgctctacgagggcggcgccgtcgacgcccgcgacgagatccgcttc
gcccgcttcggcctcgactggctcggcgaccgccgcggccccggcccgagcaccgaggac
cgcgctccgggcgccggtcgcgccaccgtcctcggctcccccgcgagcaccgggggcaga
tacggaaaggcgctgcgcttcgacggccgcgacgacgccgtacgcctgccctaccgggac
gaactcccgctcggcggccgcgacttcaccagctcgctgtggttcaggtacaccgccacc
acgggtgagcagccgatgctctggatgggcgggatcggcaccacccagccgcaggtctgg
ctgcgcggcgagcccgcctcgaaccggatcaccgggctgatcaccacccgccagggcgcg
accccgcccacgaccgcctcggtgcgcaccaccggggcgtacaacgacggccggtggcac
catctcgcgctgcggcgcggcggcggcaggctgagcctcttcctcgacgggacgccggtc
accgccgccgacgtgccgggctcggtgacccgcacctcacccttcggcgtgcatgtgggg
cagcgcctggacagccgggcgttcttcgacggcgacctcgacgaggtacgggtctacgca
cgggcgctgagcgacaccgagatccgcggactcggcggcaagggcgccgcggtgaccggc
agcccgctgctgcggctgccgctcgaccgggtcggcgagcggcccgcccgcggggccggt
cagccgcgcgggggcgaggggtag

DBGET integrated database retrieval system