KEGG   Streptomyces albus DSM 41398: SLNWT_0584
Entry
SLNWT_0584        CDS       T03823                                 

Definition
(GenBank) SalF
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00525  Acarbose and validamycin biosynthesis
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SLNWT_0584
Enzymes [BR:sals01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     SLNWT_0584
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: AJE80960
UniProt: A3FKK6
LinkDB
Position
745328..746497
AA seq 389 aa
MTAGQAGRGAGADEVRAVLLAGGEGRRMGPLGTGRLKPLIPFGGTSRLIDFSLANARRSG
LSEVLLLSQYEEQRLMDDLHQVWNSSRGFRVHFGPYDEAYRRLPADELPEKLPEPGGPRE
RGTADAFLHKAAHVFGGRPSEILILHADHVYRFDYRDMLREHRASGAALTLAYQRIERRY
VHLFGMVEFDAGGNLTNFVEKPAEPSSDLVFAAFCVFDSACLQRYLERLDGTDWQHDISR
DVIPAMLAGGERIRGHLVRGHWEDIGTVDRYLRAHLALLADPPTLPLDRMPLTIRPEVPR
RFLSSAAGVRSSLVPSDVRNAGLVERCVLFPGVRIGEGATVRDSVLLPGAEVPAGARIDA
SIVLEDGSVQPVGPDRPEDASARTCPGIG
NT seq 1170 nt   +upstreamnt  +downstreamnt
gtgacggccgggcaggcgggccggggggcgggtgcggacgaggtgcgcgccgtcctcctc
gccggtggcgaggggcggcgcatggggcccctgggcaccggtcggctcaagcccctcatc
cccttcggcgggaccagccggctgatcgacttcagtctggccaacgcccggcgctccggc
ctctccgaggtgctgctgctgtcccagtacgaggaacagcggctcatggacgatctgcac
caggtgtggaactcctcccggggcttccgggtccacttcggcccgtacgacgaggcgtac
cgccgactgcccgccgacgagctgccggagaagctgcccgagcccggcgggccccgggag
cgcggcaccgccgacgccttcctgcacaaggccgcccatgtgttcggcggccgtccgtcg
gagatcctgatcctgcacgccgaccacgtctaccgcttcgactaccgggacatgctgcgg
gagcaccgcgcctccggggccgccctgaccctcgcctaccagcgcatcgagcggcgctac
gtccacctcttcgggatggtggagttcgacgcgggcgggaacctcacgaacttcgtcgag
aagcccgccgagccgagcagcgatctcgtcttcgcggccttctgcgtcttcgactcggcg
tgcctgcagcggtatctggagcggctcgacggtacggactggcagcacgacatcagccgg
gacgtgatccccgccatgctggcgggcggcgagcggatccggggccacctggtgcgcggg
cactgggaggacatcgggacggtggaccgctacctccgcgcccatctggcgctgctcgcc
gacccgcccacgctgccgctcgaccggatgccgctgaccatccggccggaggtcccgcgg
cgctttctgtcctcggccgcgggcgtacggtcctccctcgtgccgtccgacgtacgcaac
gccgggctcgtcgagcgctgtgtgctcttccccggagtgcggatcggggagggggccacc
gtccgcgacagcgtgctgctgccgggcgcggaggtgcccgccggtgcgcggatcgacgcc
tcgatcgtcctggaggacggttcggtgcagccggtcgggccggatcgcccggaggacgcc
tccgcccggacgtgtccgggcatcggctga

DBGET integrated database retrieval system