KEGG   Streptomyces albus DSM 41398: SLNWT_0888Help
Entry
SLNWT_0888        CDS       T03823                                 

Definition
(GenBank) polyketide synthase type I
Organism
sals  Streptomyces albus DSM 41398
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thioesterase Thiolase_N Docking Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AJE81264
UniProt: A0A0B5EII1
LinkDB All DBs
Position
complement(1194261..1205444)
Genome map
AA seq 3727 aa AA seqDB search
MSDTQKPMSNEQKLLSYLKRVTSDLDEANKRLKDAEDREHEPIALVGMGCRFPGGVRSPE
QLWRLLAEGTDALVPFPADRGWDLAALYDEDPDRAGTSYVREGGFLDGAAEFDPAFFGIS
PREAKAMDPQQRILLEVAWAALEGAGLDPAALRDSRTGVFMGTNGQDYGALFGALAAEDG
LEGYLGTGNAASVLSGRLSYVLGLGGPAVTVDTACSSSLVSLHLAAESLRRSECSLALAG
GATVMATPRVFVEFSRQRGLAADGRCKAFAAGADGTGWGEGAGILVLERLSDARRNGHQV
LAVLRGSAVNQDGASNGLTAPNGPAQQRVIRQALAQARLTPDQIDAVEAHGTGTTLGDPI
EAQALLDTYGRNRPAERPLWLGSVKSNLGHTQAAAGVAGVLKMVLALRHGTLPRTLHIDS
PTPHVDWSTGGVQLLTEQREWPALDRPRRAGVSAFGVSGTNAHVILEEAPEGPAEDENHD
RPRPPVHTWLLSAATPEALRRRADQLHAHTARHPGHTPADLAHSLARAPRFPHRAAATGT
TREDLLTALDDLALREGHSEPTTAFLFTGQGSQRAGMGRELYEAFPVFAEAFDAVCGELD
RHLGRSLKAVVFGGDAELLDQTGWAQPALFAVEVALFRLVESWGVRPDFLLGHSIGEIAA
AYVAGVFSLADAAQLVAARGRLMQALPSGGAMLAVSVSGEEASRLCAGYVGRVEVAAVNG
PLACVLSGDADAVAEIEQAAREAGHRVKRLAVSHAFHSPRMDPMLAEFATVVGGLTLSEP
RIPIVSNVTGQLVQPTELTSPDYWVRHVRQTVLFHDGVRTLAREGALVFLELGPEGVLTA
AARECLAESASGGHGCTALLRRDRGEAQSVLAAVGELFTYGIDADWAGVLPGRRVELPTY
PFARERYWPEPERAGDVAAAGLQGAAHPLLGATVTLAEDEQVLFTGRLALRTHPWLADHA
VEGTVFVPGTALVELAVRAGDEVGLGRLDELTIEAPLVLPEQAAVQLQIRLGAPEPDGGR
TLALHSRQDGDQWIRHATGRLGAAAAPQLPSLDWPPADAEQVPVEGLYAHLAESGFGYGP
AFQGLRAVWRQGQEVYAEVELPEEAGAAHRFGLHPALFDAALHAVGLGEFVTGNRPSLPF
SWTGVTLHAAGAEALRVRISPAGQDTVALVAVDPGGAPVVSVEGLALRPVQGATTRRPDS
LFQVDWTELPAPEGTPNSASVWVSSAEELAALETVPARVLVSCTGSGHSPAGMVSAAHGL
AHRALGLVQDWLAEERYAAAQLVFVTRGALAAVPGEEVPDPAAATVWGLLRSAQAENPGA
FRLVDAEGAGPDAPDAGLPTPGTPDTGLPTLTTLDAELPTPASLDAALDAALALDEPQLA
LRGGRVLAPRLARATAGSEQAASLDPEGTVLITGGTGGLGALLARHLVRVHGVRRLLLVG
RRGAGAEGARELVAELAESGGEARLAACDVGDREALAALLASIPAAHPLTAVVHAAGVLD
DGVIGSLTPDRLDTVLRPKADAAWHLHELTADRDLAAFVLFSSASGVFGAPGQGSYAAGN
VFLDALAQHRAARGLPATSLAWGLWAEGGGMGGRLADGDRGRITGSGLAALTAPQGLALF
DRALGHPAPLLVPTPLDLRPSGAEVPPLLRGLIRTATRRPVAGSSGTDPGGTWTAEGVAE
LVRRQVAAVLGHSGTAAVALDRAFTEQGFDSLTAVELRNRLIAETGTRLTATLVFDHPTP
AALIAHLCARLVAGPEAAPAPSPRAPSRTRTEDDPIVVIGMACRYPGGVRSPEDLWELVA
AGREGIAGFPEDRGWDLDALFGEPGEAGRSAVREGGFLYGAAEFDAGFFGISPHEALAMD
PQQRLLLETAWEAFERAGIDPASVRGSSTGVFAGVMYHDYASGLGEVPEGVDGHLSTGNA
GSVLSGRISYALGLEGPALTVDTACSSSLVTLHLAAQALRQGECGLALAGGATVMATPTT
FVEFSLQGGLAADGRCKSFAAGADGTGWGEGAGLLLLERLSDARRNGHRVLAVVRGSAVN
QDGASNGLTAPNGPSQERVIRQALANSGLREGDIDAVEAHGTGTRLGDPIEAGALLATYG
QGREEGRPLWLGSLKSNLGHTQAAAGVGGVIKMVMALREGVLPRTLHAEEPSPHIDWDSG
AVSLLTERRDWPATGRPRRAAVSSFGISGTNAHVILEQAPAAQAPAPREPVLPGPAVPWL
LSAKSPAALRAQARALAAYAEQRPALDPADLGLSLATTRSAFEYRAAVVAEDRARLLGGL
AALAAREPADHLQEGRARQSAAPVFVFPGQGAQWQGMALELLDGAPVFAERLEECARALA
PYTDWSPTDVLRGAEGAPGLDRVDVVQPVLWAVMVSLAELWRSCGVRPAAVAGHSQGEIA
AACVAGALSLDDGARVVALRSAALRSLAGRGGMAVLPLPLAEARAALPEGVSVAAVNGPR
SVVVSGDTAPLAEVLDRVPGARRVSVDYASHSAQVEELEAELARALAPVRPRSAEVPFLS
SVTGRWLDGTELDGGYWYRNLRETVRFDEVTRILGESGSHVLIEVSPHPVLVPGLDHPGL
GTLRRDEGGTGRFRAALAEAFTQGVEADWGAVFAGARRVDLPTYAFQRERYWLRSTARTG
EVASAGVEPLAHPLLGAHLSLAEKDTVVLTGRLSAREDRWLADHAVGGTALLPGTAFAEL
ALQAAARVGAAEISELTLETPLLLPEQGALDLQVTVEAADAGGRRQLAVHARRTGEPWTR
HASGTLAPAATTEVPAVDTGWPPRGAEPVPLDGFYPALAEAGLEYGPAFRGLRAAWRHGA
DLYAEVTAPQDAEAARFALHPALLDAALHAAGLGGLGDGVRLPFSWTGVRLHRPGADTLR
VRLSPAGADALALTVLDGSGNLVATVGSLLLRPLATGRLGVQDALFQVDWRRMPVPEAGP
YPEAARTVEVDTGAGLRPTLHAALGAVQEFLRAPAAGPLVFVTRRAMDVPGQAPDAEPDP
VAAAVWGLLRSAQSEHPGLFRLLDTDGTEPPALLAAAVRGLDEPGLALRGGAAHAPRLTR
AALPAADAEVPWPGGEFGPEGTVLLTGGLGVLGRAVARHLVTAHGVRHLLLVGRSGGGAG
TADEVRAELAAAGAESVRLAACDVADRDALAALLATIPAEAPLRGVVHAAGVLDDGVVQS
LTPERLDTVLAPKAEGAWNLHELTAGLGLTAFVLFSSASGLLGAPGQASYAAANAHLDAL
AALRRAQGLPGLSLAWGLWAERGAMTAELDAAEPARNGGVRALSTEEGLALFDAARAQRD
PLRVPLRLDTAVLRARAAEEGTPHLLRELLPAPAAKPEADTAPAADLSDPLAVVRAQTAA
VLGHASADEVEADRKFLELGFDSLTSVRLRNRLNTATGLSLTATAIFDHPTPAQLAAHLA
TLLGASPGAPRQPAESGGPVAALYRAACAEGRIEAATDLLVAAARLRPAFTWQPGDADQA
PLEAVRLAASHRHSEDEDEDAGGLPLFALPSLTALSSPHQYARFGAALRERRALSVLPLP
GYVDGEALPADLGSLVGRVAEALGQHAGGGPFALAGYSSGGWLAHAVAARLEELGAPARA
LVLLDTFLPGDAADPAFRGEMVSAMFAREEDFGWATDARLTAMGGYFGLFHRWEPAPLAT
PVLLVRAERSLTGDHRPRWPGPHTPVDVPGDHFTMLEQEAAAAAGAVDAWLRTAPGAQRT
EGERTRP
NT seq 11184 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgcagaagccgatgagcaacgagcagaagctgctgtcctacctcaagcgg
gtcaccagcgacctcgacgaggccaacaagcggctgaaggacgccgaggaccgcgagcac
gagcccatcgccctggtcggcatgggctgccgcttccccggcggcgtgcgctcaccggag
cagctgtggcggctcctcgccgagggcaccgacgccctcgtccccttccccgccgaccgc
ggctgggacctggcggccctctacgacgaggaccccgaccgggcgggcaccagctatgtg
cgcgagggcggattcctcgacggggcggccgagttcgaccccgccttcttcggcatcagc
ccccgcgaggcgaaggcgatggacccgcagcagcggatcctgctcgaagtcgcctgggcg
gccctggaaggcgccggactcgacccggcggccctgcgcgacagccgcaccggtgtcttc
atgggcaccaacggccaggactacggagccctcttcggcgccctggccgccgaggacggc
ctggagggctacctcggcaccggcaacgcggcgagcgtcctctccgggcgcctctcctac
gtcctcggcctcggcggccccgccgtcaccgtggacaccgcctgctcctcctccctggtc
tcgctgcacctggccgccgagtccctgcgccgctccgagtgcagcctcgcgctcgcgggc
ggggccaccgtgatggcgaccccgcgcgtcttcgtggagttctcccggcagcgcggtctc
gccgccgacggccggtgcaaggccttcgcggcgggcgcggacggtacgggctggggcgag
ggcgcgggcatcctcgtcctggaacggctctcggacgcgcggcgcaacggccaccaggtc
ctggcggtgctgcgcggctcggcggtgaaccaggacggtgcctccaacgggctgaccgct
cccaacggccccgcccagcagcgcgtcatccgccaggccctcgcccaggcccgcctcacc
cccgaccagatcgacgccgtcgaggcgcacggcaccggcaccaccctcggcgaccccatc
gaggcgcaggccctcctcgacacctacggcaggaaccgccccgccgaacgcccgctctgg
ctcggctcggtgaagtccaacctggggcacacccaggccgccgccggggtcgcgggcgtc
ctcaagatggtcctcgccctgcggcacggcaccctgccccgcaccctccacatcgacagc
cccaccccgcacgtcgactggtccaccggcggcgtccaactcctcaccgagcagagggaa
tggcccgccctcgaccgcccccgccgcgcgggcgtctccgccttcggcgtcagcggcacc
aacgcccacgtcatcctggaagaggcccccgaagggcccgccgaggacgagaaccacgac
cggccccggccgcccgtacacacctggctgctctccgccgccaccccggaagccctccgc
cgccgcgcggaccaactgcacgcccacaccgcccggcaccccggccacacccccgccgac
ctcgcccactccctcgcccgcgccccccgcttcccgcaccgcgccgccgccaccggcacc
acccgcgaggacctgctcaccgccctcgacgacctcgccctaagggagggtcacagcgag
ccgacgaccgctttcctgttcacggggcaggggtcgcaacgggccggtatgggacgggag
ttgtacgaagcgtttcccgttttcgccgaggctttcgatgccgtgtgtggggaactcgac
cgtcacttgggccggtcgctgaaggctgtcgtcttcggtggggatgccgagttgctggat
cagacggggtgggcgcagcctgccttgtttgctgtggaagtggcgttgtttcggttggtg
gagtcgtggggtgtgcgaccggacttccttctggggcattcgatcggggagattgccgcc
gcgtatgtggcgggggtgttctcgctcgcggatgcggctcaactcgtggcggcgcggggc
cggttgatgcaggcgttgccttcgggtggggcgatgctcgcggtttccgtttcgggcgag
gaggcttcccgtctgtgtgcgggttacgtgggccgggtggaagtcgccgcggtcaatggc
ccgttggcgtgcgtactgtccggtgatgcggatgcggtggcggagatcgagcaggccgcg
cgcgaggccggtcaccgggtcaagcggctcgccgtgagccacgccttccattccccgcgt
atggacccgatgctcgccgaattcgccacagtcgtaggcgggttgaccctgtccgagccc
cggatcccgatcgtctcgaacgtgaccggccaactggtgcagccgaccgaactgacctcc
cccgactactgggtacgtcacgtccgtcagaccgttctcttccacgacggcgtacgtacc
ctcgcccgcgaaggtgccctggtcttcctggagttggggcccgaaggtgtgctgaccgcc
gccgcccgggaatgcctggcggagtccgcgtccggcggccatggctgcaccgcgctgctg
cgccgggaccgcggggaggcgcagtcggtgctcgcggccgtgggggagctgttcacctac
gggatcgacgccgactgggccggggtcctgccgggccgccgggtggagctgccgacgtat
cccttcgcacgggagcggtactggcccgagccggagcgcgcgggcgatgtcgccgcggcc
ggattgcagggtgccgcgcatccgctgctcggcgcgaccgtgaccctggccgaggacgag
caggtgctcttcaccggccgcctcgcgctgcgtacccacccctggctggccgaccatgct
gtcgagggcaccgtcttcgttcccggaaccgccttggtggagctggcggttcgggccggt
gacgaggtcggtctcgggcggctcgacgagctgaccatcgaggcgccgctggtactgccc
gagcaggctgccgtacagctccagatccggctgggggcgcccgagccggacggcggccgt
actctcgccctccactcccggcaggacggggaccagtggatccggcacgccaccggccga
ctcggcgccgctgccgccccgcaactcccctcgctcgactggccgcccgccgatgccgaa
caggtcccggtggaggggctgtacgcgcatctcgcggagtcgggcttcggctacggaccc
gccttccagggactgcgcgcggtctggcgccagggccaagaggtgtacgccgaggtcgag
ttgcccgaggaggcgggcgcggcacaccggttcgggctgcacccggcgctgttcgacgcg
gccctgcacgcggtcggcctgggcgagttcgtcaccggcaaccggccgagcctgcccttc
tcctggacgggcgtcaccctgcacgcggcgggcgccgaggccctgcgggtacggatctcc
ccggcgggccaggacaccgtcgccctggtggccgtggaccccggcggcgcgcccgtggtc
agcgtcgaggggctggccctgcgaccggttcagggggccaccacccggcggcccgactcc
ctcttccaggtcgactggaccgagctgcccgcgccggaggggacgcccaactccgcctcc
gtatgggtgagttcggccgaagagctggccgcgttggagacggtgcccgccagggtcctg
gtctcctgcaccggttcgggtcactccccggcggggatggtttccgcggcgcacggcctc
gcgcatcgcgccctcggcctggtgcaggactggctcgccgaagagcggtacgccgccgcc
cagttggtgttcgtcacccggggcgcgctggccgccgtacccggcgaggaggtgcccgac
ccggcggcggcgaccgtctggggactgctgcggtccgcgcaggccgagaacccgggagcc
ttccggctggtggacgcggagggcgcggggcctgacgcgcccgacgcgggactgccgacg
cccggcactcccgacaccggactgccgacgctcaccaccctcgacgccgaactgcctacg
cccgccagcctcgacgccgctctcgacgccgccctcgccctcgacgagccccaactggcc
ctgcgcggaggccgggtgctggccccccggctcgcccgtgccaccgccgggtccgagcag
gccgcctccctcgacccggagggcacggtcctcatcaccggcggcaccggcggtctcggt
gccctgctcgcccgccatctggtgcgcgtccacggcgtacggcggctgctgctggtcggc
aggcgcggcgccggagccgagggggcgcgtgaactcgtcgcggagctggccgagtcgggc
ggtgaggcgcggctcgcggcctgcgatgtcggcgaccgggaggcgctcgccgcgctgctc
gcgagcatccccgccgcgcatccgctgaccgccgtggtgcacgcggcgggcgtactggac
gacggggtgatcggctcgctcacccccgatcgcctggacaccgtgctgcggcccaaggcg
gacgcggcctggcatctgcacgaactcaccgccgaccgggacctcgccgccttcgtgctc
ttctcctccgcctccggtgtcttcggggcgccggggcagggcagttacgcggcgggcaat
gtcttcctggacgcgctggcccagcaccgggcggcccgcggactgcccgcgacctcgctg
gcctggggcctgtgggccgagggcggcggcatgggcgggcggctcgcggacggcgaccgg
ggcaggatcaccggctccgggctcgccgcgctcaccgccccgcagggcctcgccctcttc
gaccgggcgctcggccaccccgcgccgctgctcgtcccgaccccgctggatctgcggccc
tccggtgccgaagtaccgccgctgctgcgggggttgatccgtacggccacccgccgcccg
gtcgcgggctccagcggcacggaccccggcggcacctggaccgccgagggggtggcggag
ctcgtacggcgacaggtggccgcggtgctcggccactccggcaccgccgcggtcgccctc
gaccgcgccttcaccgagcagggcttcgactcgctgaccgccgtcgaactgcgcaaccgc
ctcatcgccgagaccggcacccgcctcacggccaccctggtcttcgaccaccccaccccc
gcggccctcatcgcccacctgtgcgcccggctcgtggcgggaccggaagccgcaccggcg
ccgtccccgcgggcgccctcccggacccgtaccgaggacgacccgatcgtggtcatcggg
atggcctgccgctacccgggcggggtccgctcgcctgaggacctctgggagctggtcgcg
gccgggcgggagggcatcgccgggttccccgaggaccgcggctgggacctcgacgcgctc
ttcggcgagcccggcgaggcgggacgctcggcggtgcgcgagggcggattcctgtacggg
gccgccgagttcgacgcgggcttcttcgggatctccccacatgaggcgctggcgatggac
ccgcagcagcggctgctcctggagaccgcctgggaggccttcgaacgcgcgggcatcgac
ccggcctcggtgcgcggcagcagcaccggcgtcttcgcgggcgtgatgtaccacgactac
gcgagcgggctcggcgaggtccccgagggcgtcgacggccatctcagcaccggcaacgcg
ggcagcgtgctctccgggcggatctcctacgccctcggtctcgaagggcccgcgctcacc
gtcgacacggcctgctcctcctccctggtcaccctgcacctggcggctcaggcgctgcgg
cagggcgagtgcggactcgcgctcgcgggcggggccaccgtgatggcgacgccgacgacc
ttcgtcgagttctccctccagggcgggctcgccgccgacgggcgctgcaagtccttcgcc
gccggggcggacggcaccggctggggcgagggcgcgggactgctcctcctggagcgcctc
tccgacgcgcggcgcaacggccaccgggtcctcgccgtggtgcgcggctcggccgtcaac
caggacggcgcgagcaacggcctcaccgcccccaacggcccctcgcaggagcgggtgatc
cgccaggccctcgccaactccggcctgcgggaaggggacatcgacgcggtggaggcgcac
ggcaccggcacccggctcggcgacccgatcgaggcgggcgccctgctggcgacctacggg
caggggcgcgaggagggccgcccgctgtggctcggctcgctgaagtcgaacctcgggcac
acccaggccgccgccggggtcggcggggtcatcaagatggtgatggccctgcgggagggc
gtgctgccgcgcaccctgcacgccgaggagccgagcccgcacatcgactgggactccggc
gccgtcagcctgctcaccgagcgccgcgactggcccgccaccggccgcccccgccgcgcc
gccgtctcctccttcgggatcagcggcaccaacgcccacgtcatcctggaacaggcaccc
gccgcccaggccccggccccccgggagcccgtgctccccggacccgccgtgccctggctg
ctctccgccaagtcaccggccgccctgcgcgcccaggcccgcgccctggccgcgtacgcc
gaacagcggcccgcgctcgacccggccgacctcggcctgtccctcgccaccacccggtcg
gccttcgagtaccgggccgcggtggtcgccgaggaccgggcgcggctgctcggcgggctc
gccgcgctcgcggcgcgggaacccgccgaccacctccaggagggccgggcccgccagagc
gccgcccccgtcttcgtcttcccggggcagggcgcgcagtggcagggcatggccctcgaa
ctcctcgacggcgcaccggtgttcgccgagcgcctcgaagagtgcgcgcgggcccttgcg
ccctatacggactggtcgcccaccgacgtcctgcggggcgccgagggcgcgcccgggctc
gaccgggtggacgtggtgcagccggtgctgtgggcggtgatggtctcgctcgccgagctg
tggcgctcctgcggggtgcgccccgccgcggtcgccgggcactcgcagggcgagatcgcg
gcggcctgtgtcgcgggcgcgctgagcctcgacgacggggcgcgggtggtcgcgctgcgc
agcgccgccctgcgctccctcgccgggcgcggcggcatggccgtactgccgctgccgctc
gccgaggcccgcgcggcgctgcccgagggggtctcggtggccgcggtgaacggcccgcgc
tcggtggtggtctccggggacaccgcgcccttggcggaggtcctcgaccgggtgcccggc
gcccggcgggtctccgtggactacgcctcgcactccgcccaagtggaggaactggaagcg
gagttggcccgcgccctggccccggtgcgccccaggtccgccgaggtgcccttcctgtcc
tcggtgaccggccggtggctggacggcaccgaactcgacggcggctactggtaccgcaac
ctccgcgagaccgtccgcttcgacgaggtgacccggattctcggcgagtccggcagccat
gtcctgatcgaggtcagcccgcaccccgtcctcgtcccgggactcgaccacccgggtctc
ggcaccctgcgccgcgacgagggcggcaccggccgcttccgggccgcgctcgcggaggcc
ttcacccagggtgtcgaggccgactggggtgccgtcttcgccggggcccgccgggtcgac
ctgcccacctacgccttccagcgcgagcggtactggctgcgctccaccgcccgcaccggc
gaggtggcgtccgccggggtggagcccctggcccacccgctgctcggcgcccatctctcc
ctcgccgagaaggacacggtggtcctcaccggccgcctgtccgcgcgcgaggaccgctgg
ctcgccgaccacgcggtaggcggcaccgccctgctgcccggcacggccttcgccgaactc
gccctgcaggcggcggcccgggtcggcgccgccgagatctccgaactcaccctggagaca
cccctgttgctgccggaacagggcgcactcgacctccaggtgacggtcgaggcggccgac
gccgggggccgcaggcaactcgccgtgcacgcccgccgcaccggcgagccctggacccgg
cacgcctccggcaccctcgcccccgctgccacgaccgaggtccccgccgtggacaccggg
tggccgccgcggggagccgaacccgtcccgctcgacggcttctacccggcgctggccgag
gccggtctggagtacgggcccgccttccgcggactgcgcgccgcctggcggcacggcgcg
gacctctacgccgaggtcacggccccgcaggacgccgaggccgcacgcttcgcgctgcac
ccggcgctgctcgacgccgccctgcacgccgcgggcctaggcggcctcggggacggggtc
cggctgccgttctcctggaccggggtacggctccaccgccccggcgccgacaccctgcgg
gtgcgcctgtccccggccggagcggacgcgctcgcgctgaccgtcctggacggctcgggg
aacctggtggccaccgtcggctcgctcctcctccgcccgctcgccaccggccgactcggc
gtccaggacgccctgttccaggtcgactggcggcggatgcccgtaccggaggcgggcccg
tacccggaggccgcgcgcaccgtcgaggtggacaccggcgccgggctgcgccccaccctg
cacgccgcgctcggcgccgtacaggagttcctgcgcgcgcccgccgcgggtccgctggtc
ttcgtgacccggcgggcgatggacgtccccgggcaggcgcccgacgcggagcccgatccg
gtggccgccgccgtctgggggctgctgcgctcggcgcagtccgagcacccggggctcttc
cggctgctcgacaccgacggcaccgaaccgcccgccctgctcgccgccgccgtccggggc
ctcgacgaaccgggcctcgcgctgcgcgggggagcggcccacgcaccgcgcctgacccgg
gccgcgctcccggccgccgatgccgaagtcccgtggcccggcggggagttcggccccgag
ggcacggtgctgctcaccggcggcctgggtgtcctcggccgtgccgtggcccggcacctg
gtcaccgcgcacggcgtacgccatctgctgctggtcggccgcagcggcggcggcgcgggc
acggcggacgaggtacgggccgaactcgccgccgcgggcgcggagtcggtgcgcctggcc
gcctgcgatgtcgccgaccgggacgccctcgccgccctgctcgcgacgatccccgccgag
gctccgctgcggggcgtcgtgcacgccgcgggcgtcctcgacgacggtgtggtgcagtcg
ctgacgcccgagcggctcgacaccgtcctcgccccgaaggccgaaggggcgtggaatctc
catgagttgaccgccgggctcggtctcaccgccttcgtgctcttctcctccgcctccggc
ctgctcggcgcacccgggcaggcgagctacgccgccgccaacgcccacctcgacgccctg
gcggccctgcgccgcgcccaagggctgcccgggctctccctcgcctgggggctgtgggcc
gaacgcggcgcgatgacagcggagttggacgcggcggagccggcgcgcaacggcggggtg
cgggccctgagcaccgaggaggggcttgccctcttcgacgccgcccgcgcccagcgggac
ccgctgcgggtgccgctgcgcctggacaccgccgtgctgcgggcccgcgccgccgaggag
ggcaccccgcacctgctgcgcgagctgctccccgcccctgccgcgaagcccgaggcggac
accgctcccgcggcggacctctcggacccgctcgccgtggtgcgcgcccagaccgccgcc
gtgctcggccacgcctcggccgacgaggtcgaagcggaccgcaaattcctggagttgggc
ttcgactcgctgacctcggtacggctgcgcaaccggctcaacacggccaccggcctcagc
ctcaccgccaccgcgatcttcgaccacccgaccccggcccagctcgccgcccacctcgcc
acgctcctcggcgcatcccccggtgcaccccggcaaccggccgagagcggcggacccgtc
gccgccctctaccgggccgcctgcgccgagggcaggatcgaggcggccaccgacctcctg
gtggccgccgcccggctgcggcccgccttcacctggcagccgggggacgccgaccaggcc
ccgctcgaagcggtccgcctcgccgcaagccaccgtcacagcgaggacgaggacgaggac
gcgggcgggctcccgctgttcgccctgccctcgctgaccgccctgtccagcccgcaccag
tacgcccggttcggggccgccctgcgcgagcgccgcgccctgtccgtactgccgctgccc
ggctatgtggacggcgaggcgctgcccgccgacctcggctcgctcgtcgggcgggtggcc
gaggcgctcgggcagcacgccgggggcggccccttcgcgctcgccggatactcctccggc
ggctggctggcccacgcggtcgccgcccgcctcgaagaactcggcgcccccgcacgggcg
ttggtgctgctcgacaccttcctgccgggcgacgccgccgaccccgccttccgcggcgag
atggtcagcgccatgttcgcgcgcgaggaggacttcggctgggccaccgacgcccggctc
accgccatgggcggctacttcgggctcttccaccgctgggagcccgcaccgctggccacc
ccggtcctcctcgtacgggccgagcgctccctcaccggggaccaccggccgcgctggccg
gggccgcacaccccggtggacgtccccggcgaccacttcaccatgctggagcaggaggcg
gccgccgccgcgggcgccgtcgacgcctggctgcgcaccgcacccggggcgcagcgcacc
gagggggagaggacccggccgtga

DBGET integrated database retrieval system