KEGG   Streptomyces albus DSM 41398: SLNWT_1677Help
Entry
SLNWT_1677        CDS       T03823                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00473  D-Alanine metabolism
sals00550  Peptidoglycan biosynthesis
sals01100  Metabolic pathways
sals01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SLNWT_1677
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SLNWT_1677
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SLNWT_1677
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sals01011]
    SLNWT_1677
Enzymes [BR:sals01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SLNWT_1677
Peptidoglycan biosynthesis and degradation proteins [BR:sals01011]
 Precursor biosynthesis
  Amino acid ligase
   SLNWT_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AJE82053
UniProt: A0A0B5EII3
LinkDB All DBs
Position
complement(2165054..2166202)
Genome map
AA seq 382 aa AA seqDB search
MSSENSSQSHETRKPRIAVVFGGRSSEHGISVVTAGAILRAIDRTKYDVLPIGITRDGRW
ALTADEPDRMGITERRVPSVDQLAESAEGAVILPVEPANREVVYAEPGLVPKALGDVDVV
FPMLHGPYGEDGTLQGMLDLAGIPYVGAGVLASAVGQDKEYMKRIFLSFGLPVGPYLVVR
PREWEQDEAGARAGIAEFAADHGWPLFIKPARGGSSMGITKVDSFEGLDEAIAEARRHDP
KFLVESLLRGREIECGVLEFEDGPRASLPAEIPPVTSHDFYDFEAKYIDSASGIVPAPLT
EEETAEVRRLAVAAFEATSCEGLVRADFFLTEDGFVINEINTMPGFTPISMYPRMWQESG
VAYPELVDRLIQAALNRSTGLR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgagaactcctcccagagccacgagacccgcaagccgcgcatcgccgtcgtc
ttcggcggccgcagctccgagcacggcatctcggtcgtcaccgccggtgccatcctgcgg
gccatcgaccgcaccaagtacgacgtgctgcccatcggcatcacacgggacgggcgatgg
gcgctcaccgcggacgaaccggaccgcatgggcatcaccgagcgccgggtgccgagcgtc
gaccagctcgccgagtccgccgagggcgcggtcatcctgccggtcgagcccgccaaccgc
gaggtggtctacgccgaaccgggcctggtgcccaaggcgctcggggacgtggacgtcgtc
ttcccgatgctgcacggcccctacggtgaggacggcaccctgcagggcatgctcgacctc
gccgggatcccgtacgtgggcgccggtgtgctcgcctcggcggtcggccaggacaaggag
tacatgaagcggatcttcctctccttcgggctgccggtcgggccctacctggtggtgcgg
ccgcgggagtgggagcaggacgaggcgggggcgcgggccgggatcgcggagttcgccgcc
gaccacggctggccgctgttcatcaagcccgcccggggcggctcctcgatgggcatcacc
aaggtcgactccttcgagggcctggacgaggccatcgccgaggcccggcgccacgacccc
aagttcctggtcgaatcgctgctgcgcgggcgggagatcgagtgcggggtgctcgaattc
gaggacgggccgcgggccagcctgcccgccgagatcccgccggtcacctcgcacgacttc
tacgacttcgaggccaagtacatcgactcggcctccgggatcgtgcccgcgccgctcacc
gaggaggagaccgccgaggtgcggcgcctggccgtggccgccttcgaggcgacctcctgc
gagggcctggtgcgcgcggacttcttcctcaccgaggacggcttcgtcatcaacgagatc
aatacgatgccgggcttcaccccgatctccatgtacccgcggatgtggcaggagagcggc
gtcgcctaccccgaactcgtcgaccggctgatccaggcggcgctcaaccgctccaccggg
ctgcgctag

DBGET integrated database retrieval system