KEGG   Streptomyces albus DSM 41398: SLNWT_2027Help
Entry
SLNWT_2027        CDS       T03823                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sals  Streptomyces albus DSM 41398
Brite
KEGG Orthology (KO) [BR:sals00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SLNWT_2027
Enzymes [BR:sals01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SLNWT_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AJE82403
UniProt: A0A0B5EJH5
LinkDB All DBs
Position
2547805..2548200
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNETLKALSTAKGSTDPATGQKALDYIAQ
IDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctattcgcccccaaggtcaaggtcagcgcacactgcgacctcccgtgc
ggtgtgtacgacccggcccaggcccgcatcgaggcggagtccgtcaaggccgtccaggaa
aagatggccggcaacgacgacccgcacttccaggcgcgtgccacggtcatcaaggagcag
cgcgccgaactcgccaagcaccacgtctcggtgctgtggagcgactacttcaagcctccg
cacttcgagaagtacccggagctgcaccagctggtcaacgagaccctgaaggccctctcc
acggccaagggctccaccgacccggccaccggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagaccaagaagggctga

DBGET integrated database retrieval system