KEGG   Streptomyces albus DSM 41398: SLNWT_2919Help
Entry
SLNWT_2919        CDS       T03823                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00250  Alanine, aspartate and glutamate metabolism
sals00410  beta-Alanine metabolism
sals00430  Taurine and hypotaurine metabolism
sals00650  Butanoate metabolism
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
sals01120  Microbial metabolism in diverse environments
sals02024  Quorum sensing
Module
sals_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLNWT_2919
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLNWT_2919
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLNWT_2919
   00430 Taurine and hypotaurine metabolism
    SLNWT_2919
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SLNWT_2919
Enzymes [BR:sals01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SLNWT_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJE83295
UniProt: A0A0B5EVN5
LinkDB All DBs
Position
3580574..3581986
Genome map
AA seq 470 aa AA seqDB search
MPLHRGARGSGSRHRTVNPFLGEANPVGGMTGAPPTHRLPDGPLPPGTAYQLVHDELMLD
GNARLNLATFVTTWMEPQAGVLMTECLDKNMIDKDEYPRTAELERRCVAMLAELWHAPDP
EAAVGCSTTGSSEACMLAGMALKRRWAARNADRYPAKDARPNLVMGINVQVCWDKFCTFW
EVEVRQVPMEGERYHLDPAAAAALCDENTIGVVAVLGSTFDGSYEPVAELCAELDALQER
TGLDIPVHVDGASGAMVAPFLDPDLVWDFRLPRVSSINTSGHKYGLVYPGVGWALWRSAA
ELPEELVFRVNYLGGEMPTFALNFSRPGAQVVAQYYTFLRLGREGYRCVQQAGRDIAKGL
AARIGELPDFRLLTRGDELPVFAFTTAEEVTAFDVFDVSRRLREGGWLVPAYTFPAHRED
LSVLRVVCRNGFSEDLAALFLDDLERLLPELRGQQGPSTTDREAATGFHH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgcatcgaggcgcccgcggttccgggagccgccaccggaccgtgaaccccttc
ctcggcgaggccaacccggtgggcggcatgaccggcgccccgcccacgcaccggctcccg
gacgggccgctgccgccggggaccgcctaccagctggtccacgacgagctgatgctcgac
ggcaacgcccggctcaacctcgccaccttcgtcaccacctggatggagccgcaggccggg
gtgctgatgaccgagtgcctcgacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgaactggagcgccgctgcgtcgccatgctcgccgagctctggcacgcccccgacccg
gaggccgcggtgggctgctccaccaccggctccagcgaggcctgcatgctcgccgggatg
gccctcaagcggcgctgggcggcgcgcaacgcggaccgctaccccgcgaaggacgcccgg
ccgaatctggtgatggggatcaacgtccaggtctgctgggacaagttctgcaccttctgg
gaggtggaggtccgccaggtcccgatggagggcgagcgctaccacctggacccggccgcc
gccgcggccctctgcgacgagaacaccatcggcgtggtcgccgtcctcggctccaccttc
gacggctcctacgaaccggtcgccgagctgtgcgcggaactcgacgccctccaggagcgc
accggcctcgacatcccggtccacgtcgacggggcctccggcgcgatggtggcgcccttc
ctcgacccggacctggtctgggacttccggctgccgcgggtctcctccatcaacacctcc
ggtcacaagtacggactcgtctacccgggggtgggctgggcgctgtggcgctcggccgcc
gaactccccgaggagctggtcttccgggtgaactacctcggcggcgagatgccgaccttc
gcgctgaacttctcccggccgggcgcgcaggtggtcgcgcagtactacaccttcctcagg
ctcggccgggagggctaccggtgcgtgcagcaggccggccgggacatcgccaaggggctg
gccgcgcggatcggcgagctgcccgacttccggttgctgacccgcggcgacgagctgccg
gtcttcgccttcaccaccgccgaggaggtcaccgccttcgatgtcttcgacgtctcccgg
cggctgcgggagggcggctggctggtccccgcgtacaccttccccgcccaccgcgaggac
ctgtccgtgctgcgggtggtctgccgcaacggcttctccgaggacctcgccgcgctcttc
ctcgacgacctggaacgcctgctgcccgaactgcgcggccagcaggggccgtcgaccacg
gaccgggaggcggcgacggggttccaccactga

DBGET integrated database retrieval system