KEGG   Streptomyces albus DSM 41398: SLNWT_4462Help
Entry
SLNWT_4462        CDS       T03823                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00620  Pyruvate metabolism
sals00680  Methane metabolism
sals01100  Metabolic pathways
sals01120  Microbial metabolism in diverse environments
sals01200  Carbon metabolism
Module
sals_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sals00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLNWT_4462
  Energy metabolism
   00680 Methane metabolism
    SLNWT_4462
Enzymes [BR:sals01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SLNWT_4462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3563
Motif
Other DBs
NCBI-ProteinID: AJE84838
UniProt: A0A0B5EQ17
LinkDB All DBs
Position
5246475..5249213
Genome map
AA seq 912 aa AA seqDB search
MSSADDQGRQAAASAELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAR
LLGETELETAAKLVRAFSTYFHLANVTEQVHRGRELRARRDDEGGLLARTADRLKDADPA
HLRETVAHLNVRPVFTAHPTEAARRSVLNKLRRIAELLQESAPSTERRRQDARLAENIDL
VWQTDELRVVRPEPADEARNAVYYLDELQAGAVGDVLEDLTAELARVGVELPEQARPLTF
GTWIGGDRDGNPNVTPQVTWDVLILQHEHGINGALESVDRLRGLLSNSIRYTGATEELLD
SLEADLDRLPEISPRYKRLNAEEPYRLKATCVRQKLENTKTRLAKGTAHEPGRDYLGTAE
LLHDLTVIQTSLRAHRGELFADGRMDVTLRTLAAFGLQLATMDVREHADAHHHALGQLFD
RLGEESWRYADMPRDYRTRLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTVKKALGVFG
PEVIESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAEIGIVPLLETTDELKAADVILD
AMLADPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLR
LFHGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVA
ATLQASALHTAPRQSDEALARWDAAMDLVSDAAHGAYRALVEDPDLPTYFLASTPVDQLA
DLHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDSVLD
EMHTHWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPEELRHVFATIEAEHALTVSEVLR
ITGGEKLLDTNPVLQQTFAIRDAYLDPISYLQVALLARQRAATEAGEEPDPLLSRALLLS
VNGVAAGLRNTG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagggccgccaggccgccgcgagcgccgagctgcgcgccgac
atccgccgcctgggtgacctcctcggcgagaccctcgtacgccaggagggccccgagctg
ctcgacctggtggagaaggtccgccgcctcacccgcgaggacggcgaggccgccgcccgc
ctgctcggggagaccgagctggagaccgccgccaagctggtgcgcgccttctccacctac
ttccacctcgccaacgtcaccgagcaggtgcaccgcggccgcgagctgcgcgcccgccgc
gacgacgagggcgggctcctcgcccgcaccgcggaccgcctcaaggacgccgaccccgcg
cacctgcgcgagaccgtcgcccatctgaacgtccgcccggtgttcaccgcccaccccacc
gaggccgcccgccgctcggtcctgaacaagctgcgccgcatcgccgaactcctccaggag
tccgcgcccagcaccgagcgccgccgccaggacgcccgcctcgccgagaacatcgacctg
gtctggcagaccgacgagctgcgcgtggtccgccccgaacccgccgacgaggcccgcaac
gccgtctactacctggacgaactccaggccggcgcggtcggcgacgtcctggaggacctc
accgccgagctggcccgggtcggcgtcgagctgcccgagcaggcccgcccgctcaccttc
ggcacctggatcggcggcgaccgcgacggcaaccccaatgtcaccccgcaggtgacctgg
gacgtcctcatcctccagcacgagcacgggatcaacggcgccctggagagcgtggaccgg
ctgcgcggactgctctccaactccatccgctacaccggcgccaccgaggaactcctcgac
tccctcgaggccgacctcgaccggctccccgagatcagcccccgctacaagcggctcaac
gccgaggagccctaccgcctcaaggccacctgcgtacggcagaagctggagaacaccaag
acccgcctcgccaagggcaccgcccacgagcccggccgggactacctcggcaccgccgag
ctgctgcacgacctcaccgtcatccagacctcgctccgcgcccaccgcggcgagctcttc
gccgacggccgcatggacgtcaccctgcgcaccctggccgccttcggcctccagctcgcc
accatggacgtacgggagcacgcggacgcccaccaccacgcgctcggccagctcttcgac
cggctcggcgaggagtcctggcgctacgccgacatgccccgcgactaccgcacccggctg
ctcgccaaggaactccgctcccggcgcccgctggcccccacccccgcgcccctggacgcg
gcgggcgagaagaccctcggcgtcttccacacggtcaagaaggccctgggcgtcttcggg
cccgaggtgatcgagtcgtacatcatctccatgtgccagggcgccgacgacgtcttcgcc
gccgccgtgctcgcccgcgaggccgggctcctcgacctgcacgcgggctgggccgagatc
ggcatcgtcccgctcctggagaccaccgacgagctgaaggccgccgacgtcatcctcgac
gccatgctcgccgacccctcctaccggcgcctggtcgcactgcgcggcgacgtccaggag
gtcatgctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggag
atccaccgcgcccagcgccggctgcgcgacgtcgcccaccgctacggcgtacggctgcgg
ctcttccacggccgcggcggcaccgtcggccgcggcggcggcccttcgcacgacgcgatc
ctcgcccagccctggggcaccctggaaggcgagatcaaggtcaccgagcagggcgaggtc
atctccgacaagtacctggtgccgtcccttgcccgggagaacctcgaactcaccgtcgcg
gccaccctgcaggcctccgccctgcacaccgcgccccgccagtccgacgaggcgctcgcc
cgctgggacgccgcgatggacctggtctccgacgccgcccacggcgcctaccgcgccctg
gtcgaggacccggacctgccgacgtacttcctcgcctccacccccgtcgaccagctcgcc
gacctgcacctgggctcccggccctcccgccgccccggttcgggcgtctcgctcgacgga
ctgcgcgccatcccctgggtcttcggctggacccagtcccggcagatcgtgcccggctgg
ttcggcgtcggctccggcctgaaggcgctgcgcgaggcggggctcgacagcgtcctggac
gagatgcacacccactggcacttcttccggaacttcctgtccaacgtcgagatgaccctc
gccaagaccgacctcaggatcgcccggcactacgtcgacaccctggtccccgaggagctc
cggcacgtcttcgccaccatcgaggccgaacacgccctgaccgtcagcgaggtgctgcgc
atcaccggcggcgagaagctcctggacaccaacccggtcctccagcagaccttcgccatc
cgcgacgcctacctcgacccgatctcctacctccaggtcgccctgctcgcccgccagcgc
gcggcgaccgaggcgggcgaggagcccgacccgctgctctcccgcgccctcctgctctcc
gtcaacggggtcgcggcggggctgcggaacaccggctga

DBGET integrated database retrieval system