KEGG   Streptomyces albus DSM 41398: SLNWT_4649Help
Entry
SLNWT_4649        CDS       T03823                                 

Definition
(GenBank) glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00564  Glycerophospholipid metabolism
sals01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SLNWT_4649
Enzymes [BR:sals01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SLNWT_4649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AJE85025
UniProt: A0A0B5F098
LinkDB All DBs
Position
5430613..5432304
Genome map
AA seq 563 aa AA seqDB search
MGPEQRAEALAAMAEKELDVLVVGGGVVGAGTALDAVTRGLATGIVEARDWASGTSSRSS
KLIHGGLRYLEMLDFTLVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERWYAGSGV
ALYDAMSMARGHGRGLPMHRHLSRRHALQVAPCLRKDALVGALQYYDAQMDDARYVATLV
RTAAAYGAKVANRARVTGFLREGERVVGARVEDVEAGGEYDIHAKQVVNATGVWTDDTQG
LVGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIVGTTDTDWDL
DKAHPAASSADIDYLLEHVNSVLAVPLTRDDVEGVYAGLRPLLAGESEATSKLSREHTVA
HPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVADCVTEDVPLVGAEGYRALWNARA
RLAQRAGLHVVRVEHLLDRYGSLTEEVLALIAEDPSLGEPLKHAEDYLRAEIVYAASHEG
ARHLDDVLTRRTRISIETFDRGARSAQEAAELMAPVLGWDKDQIAREVAHYEKRVEAERE
SQRQPDDLTADAARLGAPDIVPL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggagcagcgggccgaggcgctcgcggcgatggccgagaaggaactcgacgta
ctggtcgtgggcggcggcgtggtcggcgcgggcaccgccctggacgcggtcacccgcggc
ctggccaccggcatcgtcgaggcgcgcgactgggcctccggcacctccagcagatccagc
aagctgatccacggcgggctgcgctatctggagatgctcgacttcaccctggtgcgcgag
gccctgaaggagcgcggactgctcctggagcgcctcgccccgcacctggtcaagccggtg
cccttcctctaccccttgcagcacaaggggtgggagcggtggtacgcgggctccggcgtc
gccctctacgacgcgatgtccatggcccgcggccacggcaggggcctgccgatgcaccgc
cacctcagccgccgccacgccctccaggtcgccccctgcctgcgcaaggacgccctggtc
ggcgccctgcagtactacgacgcccagatggacgacgcccgctatgtcgccaccctggtg
cgcaccgccgcggcctacggcgccaaggtcgccaaccgggcccgggtcaccggcttcctg
cgcgagggcgagcgcgtggtcggggcgcgggtggaggacgtcgaggcgggcggggagtac
gacatccacgccaagcaggtcgtcaacgccaccggggtgtggaccgacgacacccagggc
ctggtcggcgagcgcggccagttccacgtacgggcgtccaagggcatccacctggtggtc
cccaaggaccgcatccactccagcaccgggctgatcctgcgcaccgagaagtccgtgctc
ttcgtgatcccctggggccggcactggatcgtcggcaccaccgacaccgactgggacctg
gacaaggcgcacccggccgcctccagtgccgatatcgactacctcctggagcatgtgaac
tcggtgctcgcggtcccgctcacccgggacgacgtcgagggcgtctacgcggggctgcgg
ccgctgctcgccggggagtccgaggccaccagcaagctctcgcgcgagcacaccgtggcg
cacccggtgcccggcctggtggtggtcgcgggcggcaagtacacgacctaccgggtgatg
gcgaaggacgcggtggacgaggcggtgcacgggctcgaccagcgggtggccgactgcgtg
acggaggacgtgccactggtcggcgcggaggggtaccgggcgctgtggaacgcccgcgcc
cgcctcgcccagcgcgccgggctgcacgtggtccgcgtcgagcacctcctcgaccggtac
ggctcgctcaccgaggaggtgctggccctgatcgccgaggacccgagcctcggcgagccg
ctgaagcacgccgaggactacctgcgcgccgagatcgtctacgccgcctcgcacgagggc
gcccgccacctcgacgacgtcctcacccgccgcacccgcatctcgatcgagaccttcgac
cgcggtgcgcgcagcgcccaggaggcggccgagctgatggccccggtcctgggctgggac
aaggaccagatcgcccgcgaggtggcgcactacgagaagcgggtcgaggccgagcgcgag
tcccagcgccagcccgacgacctgaccgcggacgcggcccggctcggggcgccggacatc
gtgcctctgtag

DBGET integrated database retrieval system