KEGG   Streptomyces albus DSM 41398: SLNWT_5537Help
Entry
SLNWT_5537        CDS       T03823                                 

Definition
(GenBank) putative fatty-acid--CoA ligase fadD26
  KO
K12426  long chain fatty acid CoA FadD26
Organism
sals  Streptomyces albus DSM 41398
Brite
KEGG Orthology (KO) [BR:sals00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sals01004]
    SLNWT_5537
Lipid biosynthesis proteins [BR:sals01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   SLNWT_5537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AJE85913
UniProt: A0A0B5ESY3
LinkDB All DBs
Position
complement(6459033..6460781)
Genome map
AA seq 582 aa AA seqDB search
MTSDSPPTGPLLTDHLRHWAATRAHQRAFTHVDFPGPTAPGTHRSLSWRALDERVRAVAD
GLLRVAAPGERAALVLPQGLDYVSAFLGCLYAGVIAVPLFTPELPGHEGRLAGVLRDCEP
ACLLVTSAGGPTVAAFAAEHGLPEVAQLPVDELLTPGTGRLPSPAPEDIAYLQYTSGSTR
TPAGVLISHANVLANARQGIAALNPAALPVTTVGWLPLFHDMGLLLSVAAPVTGGFPSVL
MDPVAFLEEPARWLRLLGGCPGAISAAPNFAYDYCVARTDEDTVDELRLERVRALLNGSE
PVRGTTLERFAAHFAPAGLAPEALCPAYGLAEATVFVTSDSPDRAPDTVHCSAAALAEGR
VEPGAPGEGRTALLVCGPPAGQEIRVADPATGAVLGPGVVGEIQLRGPNIGLGYWKKGQL
SADCFGVHAPGEGAAEGGWLRTGDLGALHEGRLLVTGRLKDLIIVDGRNHYPQDIEETVQ
SALAVVRRDRLTAVGVPAADGAGEELVVIAEHRRGLAPGPAEAREALALARAAVSARHGV
RLADLVLVAPGAVPRTSSGKVARAASRARLTSGGFAAVEAGR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgattcgccccccacgggcccgctgctcaccgatcacctgcggcactgggcc
gccacgcgtgcccaccaacgcgccttcacccacgtcgacttcccgggcccgaccgccccc
ggcacgcaccgcagcctgagctggcgcgccctggacgagcgcgtccgggccgtcgcggac
gggctgctccgggtggccgcgccgggcgaacgcgccgccctcgtcctgccgcagggcctc
gactacgtcagcgccttcctcggctgcctctacgccggggtgatcgcggtgccgctgttc
acccccgaactgccgggccacgaggggcggttggcgggcgtgctgcgcgactgcgagccc
gcctgcctgctcgtcacctcggcgggcgggccgaccgtggcggccttcgccgccgagcac
gggctgcccgaggtggcccagctcccggtcgacgaactgctcacccccggaaccggtcga
ctcccctcgcccgcaccggaggacatcgcctacctccagtacacctcgggctccacccgc
acccccgcgggcgtgctgatcagccacgccaatgtgctcgccaacgcccgccagggcatc
gccgccctcaacccggcggccctgccggtcaccacggtcggctggctgccgctcttccac
gacatgggcctgctgctcagcgtcgccgccccggtgaccggcggcttcccctcggtcctg
atggacccggtggccttcctggaggagcccgcccgctggctgcgcctgctcggcggctgc
cccggcgcgatcagcgcggcaccgaacttcgcctacgactactgcgtggcccgcaccgac
gaggacaccgtcgacgaactgcgcctggagcgggtacgcgccctgctgaacggcagcgaa
ccggtccgcggcaccaccctggagcgcttcgccgcgcacttcgcccccgccggtctcgcc
cccgaggcgctctgcccggcctacggcctcgccgaggccaccgtcttcgtcaccagcgac
tccccggaccgggcgccggacaccgtgcactgctcggcggcggcgctcgccgagggccgc
gtcgagccgggcgccccgggcgagggccgcaccgccctcctggtctgcggcccgcccgcc
gggcaggagatccgtgtcgcggacccggcgaccggcgccgtcctcggccccggcgtggtc
ggcgagatccagctgcgcgggcccaatatcggcctgggctactggaagaagggccagctc
agcgccgactgcttcggggtgcacgcccccggcgaaggggccgcggagggcggctggctg
cgcaccggggacctcggcgccctgcacgagggccgcctcctggtgaccggacgcctgaag
gacctgatcatcgtggacggccgcaaccactatccgcaggacatcgaggagaccgtgcag
tcggccctcgcggtggtacgccgcgaccgcctcaccgcggtcggcgtgcccgccgcggac
ggcgccggcgaggaactggtcgtgatcgccgagcaccgcagaggcctcgcccccgggccc
gccgaggcacgcgaggccctggcactggcccgcgccgcggtctccgcccggcacggggta
cgcctcgcggacctggtgctcgtggcaccgggcgcggtcccccgcacctccagcggcaag
gtcgcacgcgccgcctcccgcgcacgcctgaccagcggcggcttcgccgcggtggaggcg
gggcgatga

DBGET integrated database retrieval system